ELF<4b4 (44\\\\2d|  /usr/lib/ld.so.1Ll0F|W9N+r=dJ}-eF%(P$8<]!@kMYu}&gwS9h@'^Cbo7^;_OABz3r ~sXY` {>Rq]n#:q/I2c6K,uK/Xi`oym2b:-%apcek>GfVE[I?5~UP jHyf=lx# +n13[g?) {!5<\NOt8MH;JwSsv_iLmRp.QTxCjah"|,W()Gz$*Z4Dd7'D *.EUZ0B61Q& "4TA\vVt <%\677$7<< ( ( ( \  ,4<@pD  %tD /( 640 DV<t ]'L t 4D $  `` , H8 $   D /h6t=   G|PE8 Zxp8 y|` dD x  $ l <l \ ,x1@!64( B XdX fx {8    x \ X$L    $! - L 8<( F8 Q0We $ msT z<pl %D` 0ph g$D (   ( + ;B ImPX Y@ f` T8H PpX   x ( (   8H *hP 0(7h IT] 8H k\ z   |  t@ Dt H `( ! %*x <O,d E!( Wh a  p$w| p0  g >x H \ l @| L   1$ B$( Ox8 Y`$ ~@p A, l h 0@ \   $  b8(  l $H+P 4H  D  Qi4 Zt p`x[p Ch @  8 (  8 4  H(   , 2p Dd WW0 l v | $  , `   < P ( $@ 5@  k M ( !\ 6h > I  V8 c4x h  T  p,  0 |!      , T fp D (t 38 9h M WR b hT z ` ,   X D t D, @  h8   |   & >d G N Tt jghP x @X 4 \  !4  @  8   | l0 x )B  2|  D ( Q  e j\ se( {x  <  P  _ p    ( \ , "( /'H 9@ Iid S( bi|( D p D 4@< H m( 8 D0X $$ L('-4T4 BR Mh ahΰ\ uT L8  T  H ( @|  ( F <X 0?d ?hX8 OVh iowш ED H Ah %< F  __posix_asctime_rfrontcmpurl_freeurl_errorgetoptregister_htmlftp_last_respline_startdetermine_screen_widthmd5_process_bytesreadgmtimeselect_fdwtimer_newrbuf_read_bufferfuloptretrieve_from_filerewrite_shorthand_urlatoihost_cleanupwtimer_allocaterewindrbuf_discardcleanup_html_urlstrtokstrtolmkalldirsgetpwuidcloseportglobal_download_countftp_listvfprintf_environ_endprogress_schedule_redirectconvert_all_linksmemmoveregister_redirection__urem64hash_table_countwtimer_deletestrduphash_table_newstring_set_containsfork_iobunique_name__register_frame_infoget_urls_filegen_md5_context_size__posix_ctime_rretrieve_tree__flsbuf_sch_touppergen_md5_finishres_match_path_GLOBAL_OFFSET_TABLE___posix_getpwuid_rwtimer_elapsedstring_cmpurl_stringsleepremove_linkcount_charencode_stringslist_freeabortgethostbynamelegiblemkdirsetvalsignalacceptstrcasecmpdownloaded_increase__posix_sigwaitatexithtml_quote_stringexitrandstrerrordebug_logprintflogflushstring_set_free__posix_ttyname_rxstrdup_realurl_skip_schemeoptoptusleephas_wildcards_pmd5_init_ctxdownloaded_exceeds_quotaaccessmallocskip_lwssprintfbindtextdomainsymlinkprogress_createhash_table_getheader_strduprbuf_flushgettextgen_md5_update_initftp_pasvaddress_list_match_alltouchfwritemd5_process_blocktextdomain__udiv64xrealloc_realmake_directorysetsockoptmd5_finish_ctxexec_name.umulfree_keys_and_valuesfputsaccept_domainh_errnourl_parsefile_non_directory_p.uremfree_netrctimeurl_set_dirlong_to_string.remhash_table_removehome_dirlegible_very_longres_parsescheme_disablesscanfftp_retrgetuidno_proxy_matchftp_restlogprintfset_connection_host_namesave_log_pslist_containssearch_netrcqsortgen_md5_initfcloseurl_filenamegetenvfree_vec_getopt_internalhash_table_clearwtimer_reseturi_mergemunmapmake_nocase_string_hash_tableselect__xnet_bindsepstringconnect_to_manyrecursive_cleanupmktimeslist_appendprintwhatstrncpyacceptablemerge_vecsprogress_finishcleanup_DYNAMICrbuf_peekrenamegetproxyrbuf_initialize_sch_tolowerlog_initaddress_list_copy_onestrncmpbuild_cookies_requesthttp_atotmprintf__iobheader_processsetlocalefilenores_cleanupurl_set_filedownloaded_files_freeconvert_linksftp_cwdslist_prependstrcatstrncasecmpioctlres_retrieve_file__posix_getpwnam_rset_cookie_header_cbinet_addrwriteftp_responseaddress_list_set_faultydownloaded_filereallocstrrchrvsnprintfstrpbrkftp_systheader_existsftp_get_listinghttp_loopredirect_outputhttp_cleanuppretty_print_addressfnmatchheader_get_sch_istableftp_parse_lsvalid_progress_implementation_pmatch_tail_exitfile_exists_pslist_nreversehash_table_destroyurl_schemeenvironperrorsrandhash_table_puterrnoftp_loopunlinkstrchrsave_cookiesacceptportfile_mergelstathash_table_get_pairinet_ntoainitializeutimeregister_downloadfreesuffixhash_table_containsoptindgetsocknamecloseftp_typeretrieve_urlstrdupdelimstring_set_addmap_html_tagscalculate_skey_responseopenretr_rateoptargfgetc__deregister_frame_info___errnostrcmpfgetsheader_extract_numberlog_set_flushopterrurl_has_schemeftp_indexfree_urlposmemchrnumdigitgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_progress_handle_sigwinchfopenftruncatememsetftp_portpath_simplifybindportrbuf_uninitializexmalloc_realscheme_default_portmmaptime_strlogputsdatetime_strread_fileread_file_freexstrdup_loweraddress_list_get_boundsload_cookiesaddress_list_releaseasctimestrcpyread_whole_line_etextres_register_specs_lib_version__eprintffflushsufmatchlog_closehash_table_mapmemcmp__posix_getlogin_rgetopt_longget_urls_htmlftp_loginftp_pwd__xnet_socketlookup_hostaccdirmainftp_sizereadlinknetrc_listftp_process_typemake_string_hash_table.divversion_stringchmodmemcpyurl_full_pathparse_lineres_parse_from_filestrlenget_contentsfork_to_background__xnet_connectmd5_read_ctxrotate_backupsstrstrlocaltimestring_hashstaturl_skip_unameprogress_updatestrptimeres_get_specs_finiireadsleep_between_retrievalsconnect_to_onecookies_cleanuplistenrbuf_initialized_pfstatfprintfcalc_rateconaddrherrmsgisattytest_socket_openwtimer_granularityiwriteset_progress_implementationlibsocket.so.1SUNW_1.1libnsl.so.1SUNW_0.7libc.so.1SUNW_1.1libsocket.so.1libnsl.so.1libc.so.1 =' =(  ='tL|x|=ikLONq!(4S@LfXd pm|1ve'c_j B$0_<fHT`lxA)/My|C^20I l,8 DXP~\h5t6i/Q `(4(@oL\XVdp|8<}h}xd u$Z0l<HTz`lFxI yb"8C+ @D# @@ʐ @<@z, @ =|"@L-@1@2㿐/@ @" @   ?@$`  `` @    "㿐㿐/ˮ【 ``  @ 㿐㿐@㿐@㿐@㿐@㿐@ג㿐@Ԓ㿐@ђ㿐@͔㿐 1 p`"" pʐ a@z5 F p`2 " pʐ a0@z) HP    7////#7@+11 p "@ԗ "@Ԕ!P.` p3 @I   @ԉ!p,`2@I   @Ԃ *= h`@{   @w   @u? 2 =@`!@I = (`ʐ!@I0@a !@[!@\@I @S"H@*ޔ6?.`@*ؔ6`|  @* ?Рp  @-6 *   *@$ '4 '0  @ 0`?㿈1 X!%1 ?'$#"l   @   $#?c @  <` #!P2 5 X $% X$$ $  Xcؔ 4@`l @cؒa c@I`!Ȑ?$c7 ! c@IU! cؔ '`l@c؀ 6@Ӳc!`c@I?!Ȑ?$c 6c@Ӹ   @Ӟcؒa c@I*!Ȑ?$cذ Pp  @Ӕ6 ,`  , $ @Ӈ  $''  @x㿈<# #%'cؔ  ؀  1l@qcؒ &  !  @H! 㿐? %@D=`( ʐ!@HВ%#؀?" ?@4=`( #@H!Ȑ?&#؁H '@3 11& h h 㿐<# ؀ # ؐz ? @`" ؀  ?@"@ ?@`"؁㿐5 <# ؀  ؐF ? @`" ؀  ?@"@ܔ? @һ`"؀ &Ӳ@㿐@ҍ㿐@Ҋ㿐@qK (? P" " "" " " " " " " $㿐 " @ҩ  " @ң  " @ҝ @җ@ҕ㿐%1t " @Ҏ@v? ?#`@҅ : @v=,t@&0㿐1 t`@` "&@ `@3  2 `@-  2&@ $ 2`&@ p1 t`@'Ð $t@H@u  ?#p@?  :@,@@u t@&耢  䔒 䀢`$"`$& $& $n <#a@G" t!<& $@p& $'!<t@&}#!`@ @ʆ"8    "`ʘ"p #\ #d #`@GW㿈%1t J@'  Ed좒 @쀢`"'`$1"`$@@@u~` ?#`@@Đ :.`@u| t @%耢 2 `$ʐ"b@v!tt@&I@Ѡ0@&= (`@G"㿈``2  ʐ"b@vʔ!H 2"@ "İ @pS& @pO& ʒc@z    "  "@[@p2&  ʒc@]   d b"   "@>@p& * ʒc@A  " H FD'  ?#`@&,@@=H & & 1 x @ Y W& I ʒc@  A #0?耧 '  ?#`@,@ʐc @#0D1-  xʒ #8& B' B'@@ D&  & 2  ʐc(@Δ  2  &  㿐       U <,  €,:  2 `@2ߐ ]"=;, ? ߐ ],: `"" : `=" : `;": `,2:   ; = c * @@ ? ,:  2 `@2k;=      ,:  2 `@2S" ; o ?? e ,:  ;  "Ӧ?Y c * @@? N % # , @2C "? < Q 8?,:  ;  c * @@") & [ %@  ?#`@,@@Ϯ#H@E      ? !   @ϑ#h,:@D   @@σ#@D  PXPQPQR$RRRS SS @ ( ?` @(  ` @(2`J@.-` @ ("1 ` @(2`J@.` @ (" ` @(2`J@. ` @ (`  @(2`J@`?㿐<#!`@D  @ Z`?! @D @G "N ! @D %#ܢ   , @p "  N .2@mؒ .%! @D{ @p "$ ! @Do (N ."@@ "J?`.  !` @DT 0 㿐@㿐@ 1"`x > ~` 2 = (`/` 8@D/* @ma`&  ` 2` = (`` `@D  @mJ`& `  `& 0 F0  㿐1 t`C @΅@r6 ?#`@| :,@@ @r4`t@"' && @m+ . %')ː@x . `t⠖ @s#Y@"  6 . &   㿐N@ / `@<@U   㿐1 x  *  "   ߐ  2& 㿐@`@@` @ "㿐V┒@   &   @` 2 @ͻ` 2@ "* *@? ߤ  `"` " p 5-   ?#` ǰ @ː 1 "`x@ , t 2` $ ,`-` *   ?# ` "9˰ , Ml "  $@v$@l $`$`` ` $ ,@ ː"b@r$%WV㠐@u  6`@J @G`  *  @kŐ  .  .   .  .  .  .  .  .  #.  = ; @ @  @@.` @@.`.`  .` .`.`@ ː"b@r4$W㿐 :@&@    c J* ?Д  * `. * &㿈˒`@  '!@̟ @̠@A 0f@ΐ 1["`xO@  c L  * `@2 L D #B  c L  * `@2 O  c L  * `@"  'L  c L  * `@2 L  c L  * `@" L  c L  * `@2 N  c L  * `@" N@  c L  * `@2 M  c L  * `@" L  c L  * `@2 M  c L  * `@" M@  c L  * `@2 L  c L  * `@" jL"  c L  * `@2 @˰?c ?* `@2?@jp$`@jl$` @jh $`ːa@˶   $`  "` $`  P!$`@jJ1x$`$@`-@@w1`x@  $`0@W@m(躒 2'@˃㿀`"- '1%#!`  x`@  N .a!(` ` a!(#\`#`` #d@` ` "`$ `$`2` 㿐'1t b@ H ]<#`ː!0@@|@" 1"`x˒aH@. @ΐ @۠@@@) 0;@'!P!ˠ!h@j* @˒@!tYa@ `  @ʪ!@ʷ@ʸ @@@ 6@ʙ!@ʦ@ʧ@?  @@*!㿐1`t@W@ʮ``$ 2`$ 㿐!1 t Z`@ @K t$ t㿐@U㿐@R㿐 = "a? :  ?"L [ *)*`Lu \*`L  /"  .2Ӏ`"L?̀ /2L *`L: ր@" L .2"L? /"װ `?L /`?2L "Ȱ  *`:  ?  *쀎*`:  \"L?  *: ; `[*`: 2  ~  L   L p  . h L? /"   N `J@  ]2``"NJ@ 2N^[ ! ^` `2 *    +`;  \   -` `/"J `-+`N] \* * "6  +`8*:  `]`]̚ `2# *`  `\" `]*``"  :  2   *`  L@ J(8*?[]  J  㿐@㿐@ 㿐@ 㿐@㿐 ! c 'N  (2 N T N  * @`@"N  N  * `@2 N < * @`۠  N,  N* ?Ѐ @ * `2N# * @`@"N  N  * `@2 N  `b2N@  2N 0'  ː"b (@n ! $`  ː"b 8@m  'ː"b P@m 2 (ː"b x@m , ''@H`<# '<#`'   ː"b @m ?' & @ɒ ٰ o h @f @? `"Ű 0@N@N@N@"@=| <c!˒b@<ϐ @ ?`(Uc"*` €˒b@< Ɛ"˒b@< #(˒b@< @#x@< @<#a ː#@=~@Nqs ˒b@< @Ӑ#@< @ڐ<#a ː#@=e@NXZ <c!`2 <@Ǹ#@"@Ųc!`2 @h @:%  <#` ̒bP@:  @ ?`(<c!l*` €˒b@9 "˒b@9 ː#H@4@9 @;<#a ː#@:ƒ@K0˒b@9ߐ "`˒b@9ؐ ̐"@@9ѐ  @O =*` Q  $'@ @<#a ː#@:@K@"@6@@:D  <c! `'@Ӑ @9 `r<c!`̒b@9 @ А?`5Qc *` €˒b@9p /"˒b@9i (#H˒b@9b !@Į"@į@9 0˒b@9T @đ"@Ğ@ğ @9K0˒b@9B ̐"@~@9; @ą<#a ː#@:2@K0@ī<c!` @` @9 j<#!`̒c @9@ n " E 0@ " 709b@8 @4"@8 @;!`"ː#@9ǒ   @# `$ @9{ @!!`"ː#@9ܰ (@#H@8Đ  @B  <c!` @ @8 w<#`# ˒b@8 $cp@9@ $@ - A I<0E  70?˒b@8 @"@8 @ɐ<#a "ː#@9S b@8m @ê#H@8g @ñ<#a ː#@9< 7\@J+0-b@8R @Ï#$l @c!`2 <@Á @8> <t" l<#!`̒c@8. @   "= "J!0F  70@˒b@8 @T"@8 @[!`"ː#@8 b@8 @>#H@7 @E!`ː#@8Ғ 7@I0Òb@7 @%#̐ @8 0@\ 2 <@ @7ѐ <"@ ` "@ = (`@8#@ `<  ` J@ !(? & /@v!( * & !(@'`? & /@` * & Вa0@`? & /@I * & Вa8@  @!@@T4@2 Ѐ!PД!X@ߐ? & @0  *@`& @*Вa`@ǐ@ `@ @Ґ 㿐@A㿐@>   8( `" `* *   ? ""@ 8 2  P,@ ` ?` /`/`'&/`) 㿐ך 㿐  ͚ 㿐@E㿐@BДؒ ( F( 㿐@J $$ *` $  : $ *`@J$  $ *@9 㿐@L @J㿐 @ @ *  `,`?Ā   2 2  㿐 @ @ *  `,`?Ā   2 ` @& `& 㿐 @ @j *  `,`?Ā    2 @ 㿐  *  K* *` &  : *`& @JD *@ & #  @@( * @` @@   " "*@㿐  @ @ * @`@,?@ $ $  2 $    $& 㿐 @ @ * @@` ,?@   2 `2 > &@* ?  ? & @ `@ "+   @@@ * `@  @@"`"&@@`@ 2@ 㿐   @ڕ*& 㿐  *   @   2  * J@`J@ @`**J@ 8 @  㿐@`?㿐yzcA @ `J@ @ `*J@ @  㿐@`?㿐zz`H㿐@>㿐@;㿈@H P`&@ P ?!- @@H&@! ` &  @ *@&  &@0 `&  &  @ *@&-@J@ 2ͦ2@J@ @0 % O  "@*@J?` " *? =  = (` @@s# 㿐N@! N@    @ @ "` 2 N :  @9ƀ㿐 c *  `    ,`*`+ * @ ?Е:    @L` &@ 㿐@H[&@  "@ HJ "  "  "  " "㿐@Y㿐@V "@"㿐 @@ ѐ ` (@N h .` . . . .㿐2  @2  *@``? " " 㿐@Gِ  @   , @`2  4 &ѐ ` X@N| & @G,  &  &  @   * `* * *㿐@G  && @G & &  * *  *  * 㿐@ @㿐 ?& <#!`ѐ h@d  ! ѐ @Y㿈@d'㿐!1 ̀ 2` N $ `  ̒`@G&` A= (`ѐ @3@ 61`, ֐@@& @ &`@ 㿈@0? 'D1 ̀  Q = (`ѐ Ȓ@  -$ `@U  @@  ` @G!=@g`@  @9! @  㿐 ` <ѐ ` (@M!0# d " #@ #   h " @    㿐@4  ! @, ` ` ?@ "??    㿐    2!8!H@㿐@`  ѐ ` X@M2!m 㿐!1 ̀ |c  $ ́㿐@㿐@㿐  @@c @ @* `@2`c  * `@2&` ?#`@Ϡ# N@ &@,`@"N@ #.&`@"@* `@@ # * ** :` `@ ?@* `@@: ,@*  ``2, `ђap@  `N` ; ` *  ``` <ђax@u  `N` ; ` *  ``` >, O``ђa@Z  `N` ; ` *  ``` &, 4``ђa@?  `N` ; ` *  ``` "`"ђa@'  2N` ; ` *  ``2 , `@N@ ;" `@@,` @*8N@, $  @6 .``$ @@" @EQ &@EC@ && &  @ @4&     .$ &. " @E# &@E@ && &  @ @*   & J` ! *J 2 㿐 & "@V* @[ 2    㿐    " ` !t+` € ! `?* : `5  *` €  + :  2  ``y .v-t_r p + :  2  ``2P.L-J_H-] [ + :  ' "  ѐ!a@K*!  G + (@2,@ + (@"9ѐ!a@K!À -" ѐ!a@K!Ț %  -"    -2   -" ѐ!a@J!   -   `8`"$$||$||||||||||||||||||$|t||||t|||||||||||||||||||||l,@0hl@'P  'L'T'X`'l'hݶ`h!`''''''' <@\$@'d '`'\  N ! /' '` Nc `*  `.`-`_ƀ@   * `@` >p\L  'X'X  *  'T`@#  U* `@/> G*  `@  ;* `@>/\N# *  ` $N *  ``2 ." -" _" @ * `@*  * `@*:`2`  . - _/>=iܰ *  `@  * `@*: "'2+    N:`    >2 *   !'T*  `@>#  N * `@>2 { 'TX2P  " d$l`@ *`.``$ @&.`l@ dh.`@@B]*` @BOl@Ē'h'ld, $  $ Tޔ$ $ 'dX`d!  'x`'t'ppd?@" "\'|'X T€'H'\C @r ?''h @f㿐@$㿐@!㿐@A T.1<`  "Ш  *``p `  `p, @  @S 2  `l   cl, @  @> 2  Б- "@ `&ϑ*`Г- " @A .b(   " ,.aH$@ * *    `, @ @ 2  ` @A},$@ ,$@ߑ*1" ԁ㿐.    8 ?. @ @ߒ ?㿐`  ` @ 2 `2&`     㿐@6`` <#!`#@ ] @7 /! #0@N @= <#`#P@ߘ@7  #p@є@\- @X@@ & & & & & . * && "@&  & N@ /   &  "$ " $ $xT? .ѐ#c@Gd!  -   X 0C.!D @  ` @2 @ 1',* 'ܺ5`.aD@20 .!D-`ܒ@*`@* 3 @@ 2  `4 " @ 2`"``  "  @0/  b0D0젒     " "@ @<<&@@:&bؐ̔蒒  ѐc @c؀   $ b ђb b@{c耢 ^ ђb  c *  `    , +`** :`  ?K ;n   * `@2  b U^  `RY  `LTK  =P   * `@   * `@2 j ; " 6" 3ѐ@c -ѐb9 &@ c 2L & %Ң @ ,  @@& "&L 0@P@Bΐ  &@ 㿐Ґ@Q``  &@ 㿐!1 1`" . $ = (`1 @ p㿐1 `!1 5@=`(  @| #1`쀢  Ґ `Ȗ@DA!]Q   $`Ґ `Ȗ@D4!b1 2 $$ = (`Ґ!@S㿐1 耢`(1.` 2`@ 2# (  1``ʐ !1x  @ =`(  @'  㿐  " @  " @  "& @& & & 'L?4'D'P  `,` <Ґ `Ȗ(@CŔ"[<# ?cT' ?#8?c,"@"@P??, "?P?c<#L@#@#H'?' ?#0&` "&@&`&`&`&`D#@?, ??<a *?c<@@ ` ?Ű <-?#<  ɵ"  #L@ `" 0@!@?c<@?@#<` @: 1`!`Ґ!`@lL@ !pҶ!x`(   @  ?#`(a@L ?ҒcD!@"@?ҔD!"`  @A  ?#`a@! ! " !1@  ?#! @D@ (  ?# (a@D!?(#l,#h''@   `'  '`#T Ґ @ @4D@ @oP  `Ѐ P`Ԁ` P`(`, `@ ԔD @1D @?@A  ?D# a@~?#,  Ҹ"!T` D `` j`?4 P D@;@@3D@!@@D@ @   @ ?@?4?#4@@?@?cD@@@`@ " @@ @D  ?#Ғb  #\Ґ!#\Ґ"p#` #dҐ!#d#hҐ!#h?#4 #lҐ!#l#pҐ!#p#tҐ!#t`#xҐ!#x?D` #|#Ґ!#@a`Ґ"x@@y?@t?#4 ?c4@@i@@g@h\ 6#@."@;@<@ @0a`Ґ @1 耢`1 􀤀 ذ 7԰ 7@"P "@2 Ҕ#@c L?c@?@#@L? #\#@#X' #d'  #@"q<#?   ;Ү?c@? 3J`.Ғ@ @Ȑ#@ @ `@`@@``@P1 耢`1 􀤀 k g 3Ғ@] @#8@@@ @ `@`@@``@1 耢`1 􀤀 8 !n4 !! @@:)`@@ -@ -@2D?#`. ?&`J`2#X#p@D@:&`@l?c` J@ 2 @3#@:?&`a a  @0?#`Ғc @{0J  !  Ғ@n?\ ?2  2 zct+  2 `cp ` 2 `{cД ` ` 2 T{c`` vT  UcD i?T  L{` YL ?cP`<Ֆ  ?P EL@ ?@"@?@??〘`(h? @?c@@&#@?#, ?cL ??#L{``(  ?cH `8 @u @?\L`?H`?#,  ?Ӑ `ȖH@?$3c0 @"@?0 ?#< 3 !c??T`\X "'@@'@a Ґ @1 耢`1 􀤀 ??8?@ `@ ?cT @ 50#T@2  @  5@ܐ x@ 0`@  ?J  * `@2Ӏ?#8 "?#T "?8@'?8 cL ">Ԁ J!, ` L ?"@ ` @ ` @ !@ @a Ґ @1 耢`1 􀤀 ?n?#X `@`+ @' ?#X  Ӓ`@ LL #L@ ?#@!H`5L 1 .`,@ "`,@` %Ӑ@{`耢  ?`,@`@`,@@7 `," ``* `*  `*  `*  `*  `* L@ "@?@m?` "&```3!?#\?.@,@ @  &` &@#X `@`@@a`Ґ @1 耢`1 􀤀  ) )`$ -@ϐ!0`,@@. ?#X `@`@@ǐa Ґ @S1 耢`1 􀤀 n (j (.&`@`?% ΐ#X `@`@@a Ґ @%1 耢`1 􀤀 @ /v< /` ?#\ ??#@ ' ?c@?@#@?#\ M&`L@ I?a 2E?@P!@  ?"`@;@  ?@@;!?@@;ڐ"@ @  ? @'!@# @  ?#XӒa@ { ?Ғ#@ ѐ ?#X L@6L@  '&` `&@@*@a Ґ @ 1 耢`1 􀤀  *⨠ `2C``,@0@!`"`,`,@/@`,``!Ӓ!@' <`,!@Ԡ!@@ " @Ȑa Ґ @ T1 耢`1 􀤀 ``j @ѐf   = x` @ @ @  `, a  @H?c\ ?`` #`?#0c #\@&``&` @̐?@?`?&` ?@?c0@@`2` @ba Ґ @ 1 耢`1 􀤀 2` ?` ?  *0<#!T`'H?'X'''?''!X` !1 䀢 Hʈ  $ H *"@e  @!@ ѐ  '@0ʐ&'@0Ő''ܐ | '@!@  ?`<#)h@7p@ "@"@@ ? ܒ`@8' "U@̒bH Ӑ@ƒbP I D'a 8 a  ܔ@ bXbX `,@ `@ `*  `*  `* * * @  '  ܒ@ ' 0  ''' ' `@(Ő@5Ԑ `  @1Y"`"` ``?/ @j"p@ϔӐ b@ š@ P`2`   ?'`'  `"'@6ɐ @  <   ' `'  'X``4 `  ?'X | @5[ `@4Ր H"? 9H* @@€r @'j @Ғc@  @ݐ"ܠ@@@@ 6 0Ғc@  @ʐ"@ + 0  @"@  0+9 y @@ & 2Ӓ @0Ӑ c@ @ː@# ̔@  Ғc@ Q  O %@, "`!` Ā  @{#8@ 8 ` `@? `@j#x@ ' `/ 'Đ ?'`  ?@ @L#@  0 @C#@  0@; (@  0ڀ)P &  2 P & P 2 P |`  2  @5] P  ̒`P@ g  @$" & @ X#\ @ K#``#\ @ @!`@&%! N0O ^  @Ɛ  @ ##\`Ȕ ښ6  @ @  K  2.@!#\ @ `#`#\@  !`@&%! @2Ɛ 0@2Ð  @ "@@x!@2@m!p@y@z@ Ő  @&`ܐ@X!@e@f#\@   @&Kǐ  "ª`@&` ,::`:`::;;d;d;d;d;d;d;d:`;d;d;d;d;d;d;d;d;d;d;d;d;d::;d;d:`:`;d;d;d;d;d;d:@(;l:`;d;d;d:`;d;d;d;d::;d:`;d;d:㿈@? ' @& 'n'@@$ ? @$ ?.?&" *  (@@2 J G (J M(J T(8+-2   (   P."8'Р , @e   , ? @ '.H `(8 @ *@ ` * : ( *@ ` * (:  *@ `? *@ߒ`@ =*@ =***@㿐@@  @   # `* Ԕb@ # `@i @1Ԓb@㿐@Z@t 2: @QL`'韐@N@ =2-?`N@ "(?铐@N@ "2!?`N@  "  N  "2 N 2 ? @@1&&   @0  0W( @  0W(`*㾈111 " "`"N L ."A   &N`"`` `'N N  =2 N ! , N  ,N "  N  "2 N  , N  ,2 N 2 N `؀    ` `؀ "@܀ "@  @|@ %Ԑ  ?#h@ @|@ 8 @ ސ`@p@ ה @ Ӑ@f@ ͔@ ВpC@ @V@  @ @L@ @ 0*@ @   @ @4@ @  @  @  @@@`ؠ@@܀  @ @  @0`b@#\@6܀`"@Ԓb@m@jԐ@fbԒb@b㿐Ӓ`@   N  # *` @2, ") Ԓb@ה  N  # *` @2 Ԓb@Ĕ  N  # *` @2   㿐Ӓ`@   ҔАԒb@   Ґb@  㿐1 쀢 r㿐@,㿐@)㿐@&㿐@"㿐@㿐@㿐."  R@2  : . * @I  6 ?@@?㿐!<# !`@? $#Ր#(@/$aT$`@  $`$`(#0@/$`8$`@/#@$`Ր#H$`$`$a0$`@$` #@/$`Ē#$  2$a<$`$a,$a8$a@$`$`㿐@k#X  @@      @/㿐@R#`  L @1& = !=#ՠ @ch@ @@m @/\   @@/5 Ւcx@ߔ  @ "  @0 @ 㿈Ւc@ 1!=ՠ @W#=`@b@c@0= "  1@_@l``@耢  !=ՠ @2#=@@V@T2!=ՠ @#=@z@2 Β% @n㿐ՠ#@0 X @  !=ՠ @#=@O0@㿐L  c L  * `@2 L  #c?% L *` 2 _- @$=K @.k @&@L@ _ @ -"`*@``@*L@*@@?  * `@2 L = @@ 0!  * `@2 @?   ?  * `@2@.s& 㿐 "`"! N?* .b`*` @ !=֠ @K 0=@ P  ??濒  !=֠ @1 `=@  ̔T 77 @G@-Ґ &" " " " 㿐֒`@L ( N@ 1N` ` `@<  N@ 0!=N`  ֠ @ =@C & 㿐?U S֒`@ L N@ 2N` `B `@ < N@ 1N` `2 `@ , N@ 0N` `" `@ ?N@ - !=N` 1N` ?֠ @ =@ & 㿐@.?!=& ֠ @r!=@Θ 㿐֒a8@ & 㿐 @}@-$& 㿐 "1@q1 ` N@ ~N` /@- )&r @\`,@ J?`/"?N@N@ /"`@J @,ѐ@F /, @y& 㿐N@  @-@0&@0& 㿐N@ #@- @ "@`$ @J?`/"*? " @0&@0{& 㿐N@ iN` n2 N@N` f2N@N` 2N@H& @ c * ` +` + J* ?Г:`  * `+`J  J ! ` `k"+` `m``g0 +` +`@y!@@N & 㿐N@  c * ` J+  J* ?Ѐ * @`2J5J  J -! ` `h"+ `m`(`d0`w0+ " * " *  * +  * "*+  * "*"@  *`@!@@ & 㿐<#D ?  ,  "0"0 㿐N@  <# "=$ @9$ @ǐ ' #  @## @ @+@.$ @  *@   *  *@ 㿐= H >0 "",㿈쀢   <#0 `"",?""(", 㿐<#0v ?    0  ", 㿐N@ @ !=֠ @`!=@ @++="`8 J   (@"J *  *J(Ї8 ` `(*J2?@ ?㿐N# ``: ` * J  : * `@":2   @M `?㿐<# @V㿐@㿐@ޒ㿐@ے㿐@ה㿐. * "1* a  T "& X@& T& X㿐@m3a # /"%"ސ "1* @*`"@*`P@ @*$ XB$ T@Ք,;$ X/1*` * " *  T  @T@*N`$T@`P@*5`@$TT@T*@T$X@,$XN @ `%a"  %"%"㿐N@  @}N 㿐 <   1#`01<c )c %1<#`1= @` "@|=` //"`1@G "a= `p  1` @є '/  "@ɒ?,`  @)& & 1 @< "/@/"`1@ 0 "a 㿐1= @ ` "@11"a㿐!/" 1 $"!`  $"P'L'P'T 'X   1<#`*1<c #c 1<#`1= @` "  ?'Le P= ('H'L'P'T`'X1= @` "  ?'HB 㿐 `!`!h@1 "`<@ c\@ =1 @"`@ = "`㿐1`= @"=@r ="  4  ?/3"b"㿐/b1 ?3 3a    4 '1, * "*  X " @J  4 ", a , * "* `X@ @2@E㿐-= &@*!p@ah+1 %`)== !@!@ @ %`@ @ΐ%㿐@㿐@㿐@㿐@㿐@f㿐!֠!@a @^ !֠!֒a@[@\㿐@f!=@;㿐@]!1@2(!=@U"  @@O"p@@J#h@@E"X@@@"@@; @@6#@@1!@@,#(@@'"@㾸!=@@ڒ / $ @  $ '%/)9`f;"0*` €!P#####  . z !8 0 @  P. c `ݐ p\`(g c#P_#([#W S O C@ G C ? ;"p7!@3 /!+!'!#!1 (@K! !ݠ!0@n!8@C@h!@=@b"@8@C !8ܐ 0c. "~. "w. ڐ Xp. Ӑ"i. ̐ Pb. Ő"[. #T. #M. !F. #?. # 8.  1. #0*. #@#. #. #P. x#(. q!(.  . f!. _ . X #.`,Ԕ(  !=,K( @ ݠ @#h=`@@ @,@(̐. /#Ő. ( `. !#. #. #. L@` @* : `.)*`!t €!8 @ 0    Pܐ#c`ݐ p`(`@A#!=L@@ @#@5#@  @ L@  @].  V. #`O.  (H. #hA. #`:. #H3. #@,.  8%. #.  H. z `t@#@֐#=@@ `a ??# #@ "``( "$`(aL #`  #`0  $`$`($`,#?#`?%## # " a@ p@q/@z a `< " @ @`@i # H`2 @z !=@O  @J#@o#@E @P  `,@%, ?#  `+%.*`@=@  `*@ @%$@*`@%@ $@` ?$# D. % ! 1 (ސ!ϔ@ |`1 J@ -2 #J` #= $$ ` `|!Pޒ!X@n # $ @ |@ @@0   D<   $  @   @̒@  @ #@  "`N%1/ސ# '$` ' @@ "@@ 4@ @$  @#!D ! @&R$  ! ^`@!$ @7$ "  @@  "$@$ `@@ ## H # L@!` @! H # ހ H -# (@u!Ȣ@$Ȑ #a 2@)D`#"#Đ @  @Y"@( #!\ "!(]!( !D @P%  `".  @e . 7@ tu u u u u u u u u u u u u u u u u u u u u u u u u u ttu u u u u u uu u u u tu tu u u tvvrrss$oposotvoovouuuupvvHpPvvvvvvvvvvro@oPo`s@vsotvot8otTupp0p@p v,vpvdpvvvvvvvvpqqnn,q8qTn<nLn\nlqpn|nqqnnnnnvqqqvnorvvrr4rPrlro0c@ޠp@"8   "h"pޔ"x@@ 㿐@g㿐@d 㿐@㿐@㿐@Q㿐@G㿐@DH;j&. ㉒`v"" " " " " " @?# * *2 2 "@` **2  2 "`` **2  2 "`` *2*  2 "` 㿐  &   &  7 8 x"ޒb@+  ?c* * 3 *  3 @  ` *2  + *2   2  @<㿐`  "8@ @@@@& @@ ?`@&&@`@@ `?`@є&'L@'L& L @?''''55ک@@(. 6  6 x@5-`'5:1@. 6 ( 6 V@@1 ) `''5 @. '6 ( 6 ۲@@0`(``@''50os@(. 6 @@@6 @@5 -`'5=_@@(. 6  6 @5-`'5@(. 6 @@ 6 @*@@ 1 ) `'5* @(. 6  6 @@0`(``@'5?Q@(. 6 @6 @ 5 -`'5`&@@(. 6  6 ز@ 5-`'5"=@(. 6  6 @@1 ) `'5?@(. 6 @@ 6 @@@ 0`(``@'5"W5@(. 6 @6 @ 5 -`'5@@(. 6 @@ 6 @"@5-`'5?f@(. 6  6 @@1 ) `'5)P@(. 6  6 @@0`(``@'5m@(. 6 @6 !@5 -`'= b@5-0,@@1 )   Q @0`(`@:m@ 㪄5 -5Ą ]@ 5-@S 1 ) 6(y ⁄@0`(`@9@ Ȅ5 -xs @5-0@ք1 ) =5C ᇄ@0`(`@V@  5 -*x @5-?;@1 )  ل @0`(`@#J@ 5 -?B 5-!}⁄ 1 ) gX" @0`(`@?yN@ 5 -)/D5-㩄1 ) =҄` @0`(`@/@p 5 - &߄Ƅ5-:I1 ) 5;̄@0`(`@"@5 -6u495-91 ) 蟄@0`(`@1+@e5 -= H5D@5-ʿ5㗄 1 ) *1㧄@0`(`@?$0@9 5 -Vք5Ä@5-#351 ) ?1} @0`(`@!a0@ф5 -5O@ 5-?951 ) (P1@0`(`@0@ᡄ5 -=߄5₄@5-/N55 1 )  1⻄@0`(`@:ᴄ0@㑄5 -@@ HL  㿐@㿐@<#`j!3! "%= $Ԁ`$!@ѐ  ?#`ޔȒb@@@0 @s$Ԁ`B@   :  " @ 2 @`"  @g  "!  & `&@&@ Ԁ  2   &@` &㿐 @   @g@e @c  $$ @ $$ $ $ &&@J* J2 㿈ޒb''@m  !=ޠ @ "=`@@@b  ܪ` " ˀ`:   c L@  * `@2`L@ #  " #  \2``L@   " \ * `@"L@ "L@L@ ,@`2",- €쀢 @v$"`""U@l"@쀢 @c"`#쀢  #쀢 ަ#!=ޠ @~t# =@~Ϙ A c@~` 9 c`@~X ސ/L@b@~M & c@~E  ch@~=  c@~5 != ޠ @~/#p=@~L@ @ 5*`@~K@  2# @~wђ@~?'耢  ' ` "`  ''D,㿐    @~  "@~ @~@~ 2 㿐@}˒㿐@}Ȓ㿐@}Œ㿐@}㿐@~㿐0#@~ : "  @} @}    㿐0 #ް#@} : $@} )3+3@}ؔ 2`%! %a ` @0`@}3  ᴝ㿐!3!  3!`2$!Đ#$!3!`€㿐3!`㿐3!` €㿐@ $  $ $ $ $ X$<#!<!8@}ʐ@}Ґ@`c: @!  $ @}#ޒ 㸘{ ޒ#`c: r @<#1' @}!@  #Ȑ  &@ @$ !< @ & $ ߐ#ؒc@"] @}$ 㿈'߉ 0'ߒ`( F 셠 ‰D'5㿐 !ߒ&  8 @ ' & 㿐<#!8!<@}N  F& )'  cޠ# @}; &#:  c @}<!@  U#Ȑ R@ `& !<@@}Q  @}#&@   & &  @}   "&  㿐<#!8!<@|   cޠ# @| &#:  c a<6  +@@| #ސ cȐ c< &@ `"  @|Ò @|  C @|  @| @2@|$Bߒ`Hː Y @|4㿐 =N  = L =ߒ`P@|: <c$ % 2`X@|. <c  0``@|" <c@   0`h@|  !=<c  "a<"a8 "a@ߠ @{ p@| 㿐@r 0c$ $$  $ $ $ @e$ $ ߒ`f @A  @۰㿐   & @ 4& 0# "  @K& &   & @& @ 㿐`" @@ ߒ`H* @{ @{㿈  @@@{` &  " ?ဤ $   -''DƅB'd cߐ#ؒc@ "(ߒ`@{` ؐ ,@ ,` ,` ,`  ,` ,@ ,` ,` ,`` t  > '''  FD'@  [ߐ#ؒc@ k":,@``ߐ   = ,@ ` >,@`$@   ] ,@`$@ &,@ ],@4`2ߓ,  @{p?@6"@`?"  [,@ `ߖ < =` >   ,@ ,@2,@,@ ` ],@ ` & @F@{@zɐ`@  @ g'0c* @?ߒa(@z@z@ 88,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` `   ` \'"@'.'DƅB'@{@z.@{  <@z <``c `  HH,@ ,` ,`` ,@` PP,@ ,` ,` ,` ,``c`ߒaX@z0`ߒa`@zw0ߒap @zp@z5!@` ,@ ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` ,` `   $@   ߐ#ؒc@J"@: ,@ ,@ ` @@ *,@,@㿐ߒa  㿐  @yaȀ <3 "a<#\`2 3=@z @z  3!`#0@`,0"#㿐@`,0"#c@z~ 㿐@ys㿐@yp " ""8@ ?"㿐 \㿐  &  L& 4&  @ .@㿐`  8 @yf"@$$ " "㿐@y㿐@y 㿐@y 㿐@y㿐@ "" " " 㿐@y+㿐@ $  $   $ $ & & <#`ߐ!В  !{   2"  & &㿐 2 $ &&  &&@  && <#a`"R a  !J @xՐ h " @  @n  @͐ж #<܀ <#a=#b0_2 #<c ''$  @$ ` "  " 耢   ܖ@  @@xr'܀ c(  L  @ @c  c (Ő"` Lܔ}'c`耢   @ 9@ c  ߐ"b@u!9`  `2  "`Ԑ@ "`@@@@Ԕ@@``2`@@c!D 2 !쀢 5@ 0!  !D`"#ߒ#Z c!D`@w#8@w#H @x)쀢  !@w#x@w @{@w؀ "@w쀢 @w@ '쀢   ܔԀ %3 @ẁ "@w j@@@   6  "㿈<#a`ߐ#@ "  a ސ# `2a`t  `a ̐#``  2   a 츐#Ր  !`쪐 (ǐ`$ "+ @2& @wA 2   @2aL "  2  2 @: 2 a   H} `` 2 `\ " $ @X  2  $a  ) J`"* @ @v` @v`   (?& @ $ 2 !`_ $ =Z `@` `@v   a E  #`@ 耢`3  / @ 2 @쀢 " @@v ! @  @  @o !`!(@ !`!`  !` ܐ!x 㿐@   "b@"J@ ~  "b@"M@Ր $ $ $ $ $ $ $ $@ ,@ *@v3  = (`!뜒㿐N N`` N@ @" "( N N@ "  `N@ ` 2N@ /2N@ /N`  @ua`?㿐@u  3aʉ@u@uސ 㿐3ac4㿈3!` $!3a   $!ɠ耢 @u 7  ! #!N@u@uǐɲ  !"b@ڔ"@:@7@0@-㿐!3! 2!3Ȑ $!!3!  $!!$  !"b0@#q  !@@ʒ㿈#3a !3ʙ $a!3! aʑ $!a耢  aے@u2@u0T㿐= @`!3!@$!㿈@!3'l !@ l$!@/ 2b@3aȿ 2 << Ql@Mca ha ` 4<# 73 31 2  "$ Ȏ " @x$ $ a :b 2  2$  $ $ a " *"  2 @F@ e2@,@@tt"' ?ʘ@㿐!3! "!3@8!$!!3! "!3@.!$!!3@y!$!㿐@t4㿐@t1㿐``N *`&2&c@tf  2& &&&P@ N@ /"`@'  '' &`*` &  * @ @œ*`& *`  *  "?"?"?㿐  ,    @ 2 ?` , @*     @  " @ """  `  #c(0@- @s & & &㿈''@g    $$$< #c  @s%@ `* `@#  :* `@2 :ٰN #Ԗ# " J * `@"J #2 * `@ #  * `@2 * Nc(@@! # *   :!N *  ``2 -"  * `@ #    * `@2   :!N :  ! p#P贒l #* `@ #   * `@2    *   cp@s+  쀢 &耢 2 3  c@s   쀢  2!c@r  2!쀢  @`? #I `"0   *@ @[*`$$㿐@ " ! @!0 @r#@r ސ 㿐 6     @r@`   @r@r㿐 N@f (`a%+# N  .#  ( Є ? ɵ(Є .Ѕ8Ɇ(8/(` (`8%*# N` .#``(`Є ? ɵ(Є .Ѕ8Ɇ(8/"+`+(`2  ` 㿐 ")  @6$ <#'+)  ~ "  ` ` i0`@  㿐@q@ ?#`@q :,@@ @!3!Ā M $!!Ē ů !Ĕ? 0!@k7㿐@q@m ?#`@q :,@@ @k3!Ā  Z㿐` @ ?@qg 0$    &@@@q "  "@ " "@q~&@ "`?㿐@quА 㿐!3!Ā a{ !$!ā㿐@q#㿐@q 㿐@q㿐@q; ܁ 㿈;a<'ᅠ`a D"aܖ"ƅB'쀢  "  a  `擔 0 ".  拒. "* @qޑ* !$!" 㿐\@s'D<# `   &``*D@ '#  #3@q@&aȐp   "` @q)` #T? J # 쀢`@A;?' 33!D{ ) @q=@p` ` 2"?@'#`쀢 $W@#  &ˀ?&?# ` 2"@㿈@'?; !  0#ȓ*` !Ȑ@p 㿈`  a@   a(@ 2'@'በa8'a@ F셠  &!H aP B !X a` B !h B &㿐@oݒ  㿐b㿀  @&`2&@ @ !@ !p @oܐ9 -<!$` ''  @ )  `@ P@ "B@  2 @o!I @ܒ 2 @o!@ې  @op!ȒА @ @@o 4@x9    ,+   $ $  `   @  @ooa @oia   ' 2o䀢   a@! "@o7@ ې@o1'@W #@LapX @ @E@o@o0s@o@  '^ @``@n֐"  @ @nː"8+ @@ @@n@n %0C@@n@Ґ`` ` "Ȑ ``&@ @n@  @ߐ &@n=2&@n=`x "`x㿀` ͔ @<# "&%)O'`3<  `   @ }쀢`'caD $@̐ a ؐ`@n6"㖐 @n쀢 " @n:@n; ㉒ ?'耢 "@nI쀢 "@nC  &  ''  &@4  6@㿐@m"@m"ВⲐ <a`B:``# `# ??8 <` a`8 8  `  㿈0#؀` <#`@m @n؀ @< c` `䀢 "6؀  $?@n+آ` % `܀ @n, 'ᅠ'cDFB'a `"$  @nl؀ 2$؁㿐@mT㿐@mQ㿐@mN㿐@mJ㿐N9 N%+.NN`c (`@`(@?Є  ɳ(?Є / Ѕ8Ʉ.Nϰ .㿐J  #0 @ 2J  =" @  J & #0 % 2*@`  ` 0 7  +@ ` 0 7+*@`J  "@ *@ 0`PX@4 İ㿐@ 㿐K I " c01ဢ%2. K # +`a,  * a& А  ?ɕ* А *Б: @ ɐ @   "   `   ` `"*  K  ###* @@ `K  " c0%2/ K # ( !,  * a& А  ?ɕ* А *Б: @ ɐ    "   `   ` `" `":  :,@@ @   L@J . J !hL@ @g'@g$ ?L#`/`!h! @gJ,@g  J /"* $K  "@f @f  @f  @vL !!h@g b@gS@gP@f͐㾐N + #0 % 2*@`   ` 0 7  + ` 0 7**@ `N "@ ޔ `("@ % ?*@N` "@  % 2 F /2 *@*@`*@`*@`  `N "@ /"@ 8/*@@ 㿐<# ,`   $J@  "   N 2   @J@ .J` "@f> @f;@  @@fka@f-`< `  a `,  @w  @z @@f 㿐 b"  *8J ?8J 㿐N@  ?@ #$ /@e # "@eא"@\`@eє@e͔j.>   /@e$  ` `J` /`` ``` ```` ````2 &@"` @eǐ@e,. /   @`J /2`  "@ @et` /*@ei.@8㿐@e[`?`㿐 0* * c@ `@ `  0`P @ {&K (  ,` `"8 @e"@e  @ @ː  @` @e @e @@e@e`@d@d  @ :,@`@d@d@ @,@`@d  @dߔ  @ :,@` @@dА@:@,@`$@ ` 0`PH@ &  (@ @d  ` ,@d㿐   <#Ѐ "`<#Ԁ "p@e " N  ?  !;!@dܔ$,#㿐`@`? 㿐@d;"ٛ    ` ` 2``2`@d$" 0@N @d"@d%@d&s 0@M = 0` @ @d  @d ` "b@dK `"@c@c@c E@{0<#5/-;`    a yj"v`  a "j`@\(d` $@@dv`   W - "M`T``@j@`2  `@` @Ra H@`)@c@c,@@F`2  `@` @,a `x@c  @ږah@c``2` $ " @d @c@cإ 㿐N@ /2N@R /   0`P@'q N   N@ / / /  N@ /  @   * :  /"`N 2* ,`@c0@  cȔ cȖ* * ** @cR㿐@c`   ?#`@cB cЖ@*c `* `* `* `.@ ?#`@c- cؖ@.@c `* `* `* `* `*1   @b 2  @c @b#@b@b @H @a`$$`$ 㿈N  " " '2   ? &, : @c* &@bː@6耢  @c"` ? &, : @b0* &㿐@%@bn  ?#``@b  J#&    ` ""  *J 㿐= ``3@ ? .@b5,  ` ?#N`   % 3 FN ?**** N " " * 0`P@P(h @ " 1   " 1  1  1  $㿈`!<<!耢 #  '!耢 ) $!! '̐'!@s? 㿐@a 㿐!<!耢 ’cƔ d!$!㿐@an㿐@ak㿐@ah㿐@ad㿐@b-㿐@b'㿐="`@aP (=`֮ @a- 㿐@bP  H㿐 @bF@b?  ڐ P㿐@b: А X㿐N  ! *J 2 J  *`8(8 " J  㿐&@`@a&,㿐 "@ N : #      *:  ,2 ؐ$@$@  * @`@   * `@2 N y*`$@$`㿈@`?'@`ڐ1<!  ``@a0<!*!㿀@`ڐ?'@`Ð 1< "  `p l#\#`@`0<"*"㿐<# D` @0 $ D @a} @aD @`F @`] @a3`@`V @a, D@`7 㿐N   /" N`.2 N   `. N  . N  2  . . Z  "W * : N  /2` N H`N / `N /"`@  @`x  N ./ @J  р / .  # J /"?  ? N /2? ? J@ `  @`J &    *  J . J /.`. `J . `J /``@`"   P''@`Ò? !@_ @_ А@`0   D< ( = (`!)@`  @_! @_@_ݐ 㿐@` 82 А@_0   D<  @ 㿐`@=@_  aH@_0 Ґ @_o 㿐 ݐ  㿐 @_a  ?#`@_L`/  /`? L  /2 L " ,  `@`-! `?2 ,㿐@_ / "@_+ @_' /. @_Z0㿐@_  <N N /2N /``T``X  @   `X@ `?@    @y `?JJ`" JJ@" J`?㿐 J@ /`? 2  "P &  2 㿐` @$ . U$ & @]@   $ 2 @]  `9$ $ 2@]y@] @]㿐  @^ 0@]@]㿐   @]y  @]s㿐 `*(@ "    *`2 @ * , @`2 `*` *@]K@]C㿐ː $`$  ` "&    2 & 㿐 ʐ$ $   " 2 㿐 " @\ے 2   2 㿐  @\ @\ 2㿐  ]P㿐㿐@\ِ 㿐ǐct 㿐@\ʐ@\Ȑ 㿐ǐcӔ 㿐N<`-"-" @\@]4  @  `,@ N   ,@]  2 ",`, N ,"P@GŐ㿐  @]u `0. @]q  `6`@:  6.? @ . * .pҐ㿐    @\ߒ 2 㿐``  -.  ` `c`0c @\Ȑ 0+ @\ dy 0c@)a@\#g 0"@'А@\cU 0?@#&%@\"C 0b@%}x@\@1 0@!沐@\b 0!@@\ 0@\" 0.@\\"@\ 0 .@\S@\wb 0 .@\Jb@\n@ 0 .@\A@@\e" 0 .@\8"@\\c 0 .@\/c@\S# 0 .@\&#@\J d 0 .@\ d@\A  0 .@\   0. .㿐" 㿐@ 㿐@[P @\&& P@\~ #"*$  ,  , @\"  㿐N  *:  & < > " ` `2 ` N` Ԑ`NO * : `Dɐ#(*` € &* a* m* p*2 ; &*N < g l*@ t*" ; &* q* u* o* t* ; &* #* 3* 2* ;* N * &&&&&&&&&&&&&&&&&&&&&&&&&&&&&@&&@P<#\`  =@[ `h@[˔  㿐/ZX  @Z@Z@Z㿐/Z  ??㿐㿠J㿠%s:%u: failed assertion `%s' connect.cconnection_host_name == NULLconnection_host_name != NULLConnecting to %s[%s]:%hu... Connecting to %s:%hu... connected. Created socket %d. failed: %s. Closing fd %d Master socket fd %d bound. Created socket fd %d. Deleted old cookie (to be replaced.) Stored cookie %s %d %s %s %d %s %s %s permanentnonpermanent%s:%u: failed assertion `%s' cookies.cres != 0Discarded old cookie. name_b != NULL && name_e != NULLdomainpathexpiresmax-age%lfsecureAError in Set-Cookie, field `%s'Syntax error in Set-Cookie at character `%c'. Syntax error in Set-Cookie: premature end of string. .int.mil.gov.org.net.edu.comcdm: 1 2 3 4 5 6Attempt to fake the domain: %s, %s Attempt to fake the path: %s, %s p != NULLocnt == countCookie: pos == result_sizerCannot open cookies file `%s': %s TRUE%lu%s %s %s %s %lu %s %s FALSESaving cookies to %s. w# HTTP cookie file. # Generated by Wget on %s. # Edit at your own risk. Error writing to `%s': %s Error closing `%s': %s Done saving cookies. byte%s:%u: failed assertion `%s' ftp.ccon != NULLcon->target != NULL!((cmd & DO_LIST) && (cmd & DO_RETR))(cmd & (DO_LIST | DO_CWD | DO_RETR | DO_LOGIN)) != 0user && passwdLogging in as %s ... Error in server response, closing control connection. Closing fd %d Error in server greeting. Write failed, closing control connection. The server refuses login. Login incorrect. Logged in! ==> SYST ... Server error, can't determine system type. done. ==> PWD ... /Initial VMS directory not in the form [...]! Preprocessing the initial VMS directory old = '%s' new = '%s' done. ==> TYPE %c ... Unknown type `%c', closing control connection. done. ==> CWD not needed. changing working directory %s%s%sPrepended initial PWD to relative path: old: '%s' new: '%s' *ntarget == '/'Changed file name to VMS syntax: Unix: '%s' VMS: '%s' ==> CWD %s ... No such directory `%s'. ==> CWD not required. ==> SIZE %s ... ==> PASV ... Cannot initiate PASV transfer. Cannot parse PASV response. couldn't connect to %s:%hu: %s ==> PORT ... socket: %s Bind error (%s). Invalid PORT. ==> REST %ld ... REST failed; will not truncate `%s'. REST failed, starting from scratch. ==> RETR %s ... No such file `%s'. ==> LIST ... No such file or directory `%s'. .Lying FTP server found, adjusting. accept: %s abwb%s: %s Length: %s [%s to go] (unauthoritative) %s: %s, closing control connection. %s (%s) - Data connection: %s; %s (%s) - Control connection closed. Data transfer aborted. r%s File `%s' already there, not retrieving. (try:%2d)--%s-- %s %s => `%s' %s (%s) - `%s' saved [%ld] %s URL: %s [%ld] -> "%s" [%d] Removing file due to --delete-after in ftp_loop_internal(): Removing %s. unlink: %s .listingUsing `%s' as listing tmp file. Removed `%s'. Recursion depth %d exceeded max. depth %d. f != NULLRemote file no newer than local file `%s' -- not retrieving. Remote file is newer than local file `%s' -- retrieving. The sizes do not match (local %ld) -- retrieving. Invalid name of the symlink, skipping. Already have correct symlink %s -> %s Creating symlink %s -> %s symlink: %s Skipping directory `%s'. %s: unknown/unsupported file type. %s: corrupt time-stamp. Unrecognized permissions for %s. Will not retrieve dirs since depth is %d (max %d). %s%s%s/%sComposing new CWD relative to the initial directory. odir = '%s' f->name = '%s' newdir = '%s' Not descending to `%s' as it is excluded/not-included. Rejecting `%s'. No matches on pattern `%s'. Wrote HTML-ized index to `%s' [%ld]. Wrote HTML-ized index to `%s'. %s %s%s%s PASS--> %s --> PASS Turtle Power! --> %s USER331 opiekey 331 s/key %d,%d,%d,%d,%d,%dPORTPASVTYPECWDRESTRETRLISTSYSTVMSUNIXWINDOWS_NTMACOSPWD"SIZEtype=DecNovOctSepAugJulJunMayAprMarFebJanrb%s: %s total PLAINFILE; DIRECTORY; SYMLINK; UNKNOWN; implicit perms %0o; perms %0o; month: %s; day: %d; year: %d (no tm); time: %02d:%02d:%02d (no yr); -> link to: %s ... Ignoring `.' and `..'; trailing `/' on dir. trailing `@' on link. trailing `*' on exec. Skipping. Name: '%s' -:MYYYY/MM/DD HH:MM - %d/%02d/%02d %02d:%02d Timestamp: %ld Directory File, size %ld bytes wrong VMS permissons! DECNOVOCTSEPAUGJULJUNMAYAPRMARFEBJANfile name: '%s' .DIRFile Getting additional line empty line read, leaving listing parser confusing VMS listing item, leaving listing parser second token: '%s' day: '%s' nonsense in VMS listing, skipping this line date parsed YYYY/MM/DD HH:MM:SS - %d/%02d/%02d %02d:%02d:%02d ,)confusing VMS permissions, skipping line permissions: %s -> 0%o Unsupported listing type, trying Unix listing parser. wb%s%s%s@ ���Index of /%s on %s:%d��� 

  %d %s %02d %02d:%02d         time unknown       File        Directory   Link        Not sure    %s  (%s bytes)-> %s(nil)
store is `%s' POSIXLY_CORRECT--%s: option `%s' is ambiguous %s: option `--%s' doesn't allow an argument %s: option `%c%s' doesn't allow an argument %s: option `%s' requires an argument %s: unrecognized option `--%s' %s: unrecognized option `%c%s' %s: illegal option -- %c %s: option requires an argument -- %c );Ok[WQ  /?"!,i9Ka~֝jבe  7CA f!*7ΑH^P}zdK5 _U^/%=kO[G)6F\I (QۚK5ަ5)n>5#F[uvT~>Qw%s %s:%u: failed assertion `%s' host.cindex >= al->faulty && index < al->countcount > 0Releasing %p (new refcount %d). Deleting unused %p. Caching %s => %s Found %s in host_name_addresses_map (%p) Resolving %s... failed: %s. done. u->host != NULLHost not foundUnknown erroral->refcount == 1ltgtampquotnbsp%s:%u: failed assertion `%s' html-parse.cch == '\'' || ch == 0x22ch == quote_charch == '-'thtdtablescriptoverlaymetalinklayerinputimgiframeframefigembedbodybgsoundbaseareaappletalowsrcbackgroundsrccodehrefcontentnamehttp-equivrel%s: no base, merge will use "%s". %s: link "%s" doesn't parse. %s: merge("%s", "%s") -> %s %s: merged link "%s" doesn't parse. %s:%u: failed assertion `%s' html-url.ctagid != -1stylesheetrefreshrobotsnonenofollow%s: %s Loaded %s (size %ld). no-follow in %s: %d HTTP/bytesnoneKeep-AliveInvalidating fd %d from further reuse. Closing fd %d %s:%u: failed assertion `%s' http.cpc_last_host_ip == NULLpc_last_host_ip != NULLRegistered fd %d for persistent reuse. *hs->local_file != NULLReusing connection to %s:%hu. Reusing fd %d. HEADGETReferer: %s Pragma: no-cache Range: bytes=%ld- Wget/%sAuthorizationProxy-Authorization:%dConnection: Keep-Alive %s %s HTTP/1.0 User-Agent: %s Host: %s%s Accept: %s %s%s%s%s%s%s%s%s */*---request begin--- %s---request end--- Failed writing HTTP request: %s. %s request sent, awaiting response... ProxyHTTP End of file while parsing headers. Read error (%s) in headers. No data receivedMalformed status line(no description) %2d %s%2d %sContent-LengthContent-TypeLocationLast-ModifiedSet-CookieWWW-AuthenticateAccept-RangesContent-RangeConnectioninhibit_keep_alive == 0Authorization failed. Unknown authentication scheme. BasicLocation: %s%s unspecified [following]text/html.htm.html The file is already fully retrieved; nothing to do. Continued download failed on this file, which conflicts with `-c'. Refusing to truncate existing file `%s'. Length: (%s to go)ignored [%s] abwb%s: %s Warning: wildcards not supported in HTTP. File `%s' already there, will not retrieve. htmlhtm.orig (try:%2d)--%s-- %s %s => `%s' Cannot write to `%s' (%s). Unable to establish SSL connection. ERROR: Redirection (%d) without location. %s: %s ERROR %d: %s. Last-modified header missing -- time-stamps turned off. Last-modified header invalid -- time-stamp ignored. Server file no newer than local file `%s' -- not retrieving. The sizes do not match (local %ld) -- retrieving. Remote file is newer, retrieving. %d %s %s (%s) - `%s' saved [%ld/%ld] %s URL:%s [%ld/%ld] -> "%s" [%d] %s (%s) - `%s' saved [%ld] %s URL:%s [%ld] -> "%s" [%d] %s (%s) - Connection closed at byte %ld. %s (%s) - `%s' saved [%ld/%ld]) %s (%s) - Connection closed at byte %ld/%ld. %s (%s) - Read error at byte %ld (%s).%s (%s) - Read error at byte %ld/%ld (%s). %a %b %d %T %Y%a, %d-%b-%Y %T%A, %d-%b-%y %T%a, %d %b %Y %T%s:%s%s: Basic %s nonceopaquerealm:Authorization: Digest username="%s", realm="%s", nonce="%s", uri="%s", response="%s", opaque="" DigestNTLMwaitretrywaitverboseuseragentuseproxytriestimestampingtimeoutspiderspanhostsserverresponsesaveheaderssavecookiesrobotsretrsymlinksremovelistingrelativeonlyrejectrefererrecursivereclevelrandomwaitquotaquietproxyuserproxypasswdprogresspasswdpassiveftppagerequisitesoutputdocumentnumtriesnoproxynoparentnoclobbernetrcmirrorloginlogfileloadcookieslimitratekilllongerinputincludedirectoriesignoretagsignorelengthhttpuserhttpsproxyhttpproxyhttppasswdhttpkeepalivehtmlifyhtmlextensionheaderglobftpproxyforcehtmlfollowtagsfollowftpexcludedomainsexcludedirectoriesdotstyledotspacingdotsinlinedotbytesdomainsdirstructdirprefixdeleteafterdebugcutdirscookiesconvertlinkscontinuecachebindaddressbasebackupsbackupconvertedbackgroundalwaysrestaddhostdiraccept.anonymous-wget@no_proxyHOMEWGETRC%s: %s: %s. %s/.wgetrcrb%s: Cannot read %s (%s). %s: Error in %s at line %d. /home/lahr/wget/bin/etc/wgetrc%s: Warning: Both system and user wgetrc point to `%s'. %s: BUG: unknown command `%s', value `%s'. %s: %s: Cannot convert `%s' to an IP address. onoff%s: %s: Please specify on or off. alwaysnever%s: %s: Please specify always, on, off, or never. %s: %s: Invalid specification `%s'. inf%s: Invalid specification `%s' awwget-log%s: %s: %s wget/home/lahr/wget/bin/share/localeUsage: %s [OPTION]... [URL]... GNU Wget %s, a non-interactive network retriever. Mandatory arguments to long options are mandatory for short options too. Startup: -V, --version display the version of Wget and exit. -h, --help print this help. -b, --background go to background after startup. -e, --execute=COMMAND execute a `.wgetrc'-style command. Logging and input file: -o, --output-file=FILE log messages to FILE. -a, --append-output=FILE append messages to FILE. -d, --debug print debug output. -q, --quiet quiet (no output). -v, --verbose be verbose (this is the default). -nv, --non-verbose turn off verboseness, without being quiet. -i, --input-file=FILE download URLs found in FILE. -F, --force-html treat input file as HTML. -B, --base=URL prepends URL to relative links in -F -i file. --sslcertfile=FILE optional client certificate. --sslcertkey=KEYFILE optional keyfile for this certificate. --egd-file=FILE file name of the EGD socket. Download: --bind-address=ADDRESS bind to ADDRESS (hostname or IP) on local host. -t, --tries=NUMBER set number of retries to NUMBER (0 unlimits). -O --output-document=FILE write documents to FILE. -nc, --no-clobber don't clobber existing files or use .# suffixes. -c, --continue resume getting a partially-downloaded file. --progress=TYPE select progress gauge type. -N, --timestamping don't re-retrieve files unless newer than local. -S, --server-response print server response. --spider don't download anything. -T, --timeout=SECONDS set the read timeout to SECONDS. -w, --wait=SECONDS wait SECONDS between retrievals. --waitretry=SECONDS wait 1...SECONDS between retries of a retrieval. --random-wait wait from 0...2*WAIT secs between retrievals. -Y, --proxy=on/off turn proxy on or off. -Q, --quota=NUMBER set retrieval quota to NUMBER. --limit-rate=RATE limit download rate to RATE. Directories: -nd --no-directories don't create directories. -x, --force-directories force creation of directories. -nH, --no-host-directories don't create host directories. -P, --directory-prefix=PREFIX save files to PREFIX/... --cut-dirs=NUMBER ignore NUMBER remote directory components. HTTP options: --http-user=USER set http user to USER. --http-passwd=PASS set http password to PASS. -C, --cache=on/off (dis)allow server-cached data (normally allowed). -E, --html-extension save all text/html documents with .html extension. --ignore-length ignore `Content-Length' header field. --header=STRING insert STRING among the headers. --proxy-user=USER set USER as proxy username. --proxy-passwd=PASS set PASS as proxy password. --referer=URL include `Referer: URL' header in HTTP request. -s, --save-headers save the HTTP headers to file. -U, --user-agent=AGENT identify as AGENT instead of Wget/VERSION. --no-http-keep-alive disable HTTP keep-alive (persistent connections). --cookies=off don't use cookies. --load-cookies=FILE load cookies from FILE before session. --save-cookies=FILE save cookies to FILE after session. FTP options: -nr, --dont-remove-listing don't remove `.listing' files. -g, --glob=on/off turn file name globbing on or off. --passive-ftp use the "passive" transfer mode. --retr-symlinks when recursing, get linked-to files (not dirs). Recursive retrieval: -r, --recursive recursive web-suck -- use with care! -l, --level=NUMBER maximum recursion depth (inf or 0 for infinite). --delete-after delete files locally after downloading them. -k, --convert-links convert non-relative links to relative. -K, --backup-converted before converting file X, back up as X.orig. -m, --mirror shortcut option equivalent to -r -N -l inf -nr. -p, --page-requisites get all images, etc. needed to display HTML page. Recursive accept/reject: -A, --accept=LIST comma-separated list of accepted extensions. -R, --reject=LIST comma-separated list of rejected extensions. -D, --domains=LIST comma-separated list of accepted domains. --exclude-domains=LIST comma-separated list of rejected domains. --follow-ftp follow FTP links from HTML documents. --follow-tags=LIST comma-separated list of followed HTML tags. -G, --ignore-tags=LIST comma-separated list of ignored HTML tags. -H, --span-hosts go to foreign hosts when recursive. -L, --relative follow relative links only. -I, --include-directories=LIST list of allowed directories. -X, --exclude-directories=LIST list of excluded directories. -np, --no-parent don't ascend to the parent directory. Mail bug reports and suggestions to . waitretrywaituse-proxyrefereruser-agenttriestimeoutsave-cookiesrejectquotaproxy-userproxy-passwdproxyprogressoutput-fileoutput-documentnoload-cookieslimit-ratelevelinput-fileinclude-directoriesignore-tagshttp-userhttp-passwdhtmlifyheaderglobfollow-tagsexclude-domainsexclude-directoriesexecutedot-styledomainsdirectory-prefixcut-dirscookiescachebind-addressbasebackupsappend-outputacceptversionverbosetimestampingspiderspan-hostsserver-responsesave-headersretr-symlinksrelativerecursiverandom-waitquietpage-requisitespassive-ftpnon-verboseno-parentno-http-keep-aliveno-host-lookupno-host-directoriesno-directoriesno-clobbermirrorignore-lengthhtml-extensionhelpforce-htmlforce-hierforce-directoriesfollow-ftpdont-remove-listingdelete-afterdebugconvert-linkscontinuebackup-convertedbackgroundhpVqvdkKsxmNWrHSLcFbEY:G:g:T:U:O:l:n:i:o:a:t:D:A:R:P:B:e:Q:X:I:w:C:onnoparentdeleteafterretrsymlinksignorelengthpassiveftpnoclobberfollowftpcutdirsoffdirstructaddhostdirremovelistingbindaddresshttpkeepaliverandomwaithtmlextensionforcehtmlspanhostsbackupconvertedconvertlinksrelativeonlypagerequisitesserverresponsesaveheadersGNU Wget %s %sCopyright (C) 1995, 1996, 1997, 1998, 2000, 2001 Free Software Foundation, Inc. This program is distributed in the hope that it will be useful, but WITHOUT ANY WARRANTY; without even the implied warranty of MERCHANTABILITY or FITNESS FOR A PARTICULAR PURPOSE. See the GNU General Public License for more details. Originally written by Hrvoje Niksic . httpuserhttppasswddotstyleexcludedomainsproxyuserproxypasswdfollowtagsloadcookiessavecookieslimitratelogfile%s: %s: invalid command ignoretagsincludedirectoriesinputreclevel%s: illegal option -- `-n%c' Try `%s --help' for more options. outputdocumentdirprefixuseragentexcludedirectoriesuseproxyCan't be verbose and quiet at the same time. Can't timestamp and not clobber old files at the same time. %s: missing URL Converted %s to %s DEBUG output created by Wget %s on %s. solaris2.7abwbRemoving file due to --delete-after in main(): Removing %s. unlink: %s No URLs found in %s. FINISHED --%s-- Downloaded: %s bytes in %d files Download quota (%s bytes) EXCEEDED! %s received, redirecting output to `%%s'. SIGUSR1WTF?!SIGHUP%s/%s.netrcr%s: Cannot read %s (%s). loginpasswordmacdefaccount%s: %s:%d: warning: "%s" token appears before any machine name defaultmachine%s: %s:%d: unknown token "%s" bardot %*s[ skipping %dK ] %5ldK ,%s:%u: failed assertion `%s' progress.cdp->dots < opt.dots_in_line%3d%%@Y %s. defaultbinarymegagigaInvalid dot style specification `%s'; leaving unchanged. percentage <= 100%2d%% 100% dlsz <= progress_size %-11sG/sM/sK/sB/s %7.2f%s --.--K/s ETA --:--%d:%02d:%02d%02d:%02d ETA --:--p - bp->buffer <= bp->width@Y@@ forceEnqueuing %s at depth %d Queue count %d, maxcount %d. Dequeuing %s at depth %d Already downloaded "%s", reusing it from "%s". Not descending further; at depth %d, max. %d. %s:%u: failed assertion `%s' recur.curl_parsed != NULLRemoving file due to %s in recursive_retrieve(): --delete-afterrecursive rejection criteriaRemoving %s. Removing %s since it should be rejected. unlink: %s Deciding whether to enqueue "%s". Already on the black list. Not following non-HTTP schemes. It doesn't really look like a relative link. The domain was not accepted. Going to "%s" would escape "%s" with no_parent on. %s (%s) is excluded/not-included. htmlhtm%s (%s) does not match acc/rej rules. This is not the same hostname as the parent's (%s and %s). Not following %s because robots.txt forbids it. Decided to load it. Decided NOT to load it. orig_parsed != NULLnew_parsed != NULLRedirection "%s" failed the test. /index.html!hash_table_contains (dl_url_file_map, url)file != NULLApparently %s has been removed. Scanning %s (from %s) will convert url %s to local %s will convert url %s to complete Converted %d files in %.2f seconds. @@wget%s:%u: failed assertion `%s' res.cj == cnt!EOL (p)Ignoring malformed line %duser-agentallowdisallowIgnoring unknown field at line %dCannot open %s: %s%s path %s because of rule `%s'. AllowingRejecting/robots.txtLoading robots.txt; please ignore errors. deferring a %ld ms sleep (%ld/%ld) until later. sleeping %ld ms @@GB/sMB/sKB/sB/s%7.2f %s%.2f %s%s:%u: failed assertion `%s' retr.cmsecs >= 0bytes >= 0@@@A0?PA>>%s: %s. Could not find proxy host. Error parsing proxy URL %s: %s. Error in proxy URL %s: Must be HTTP. htmlhtmmynewloc != NULL%d redirections exceeded. %s: Redirection cycle detected. Removing file due to --delete-after in retrieve_from_file(): Removing %s. unlink: %s Giving up. Retrying. sleep_between_retrievals: norm=%ld,fuzz=%ld,sleep=%d ?CBBBBQ00000000000000000000000000000000  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`ABCDEFGHIJKLMNOPQRSTUVWXYZ{|}~ftp://http://%s:%u: failed assertion `%s' url.cp2 - newstr == newlen/?@ftp://%shttp://%sInvalid user nameBad port numberEmpty hostUnsupported schemeNo error:/;?#/;?#;?#?##*p == 0error_code >= 0 && error_code < ARRAY_SIZE (parse_errors)%s: %s Loaded %s (size %ld). %s: Invalid URL %s: %s %s.%dRemoving %s because of directory danger! %s: %s%s/%s%s%s%s/index.html??;#scheme_str != NULL*password*p - result == sizehttp_proxyftp_proxyConverting %s... nothing to do. Cannot convert links in %s: %s Unable to delete `%s': %s wbSomething strange is going on. Please investigate.Skipping %s at position %d. TO_RELATIVE: %s to %s at position %d in %s. TO_COMPLETE: to %s at position %d in %s. %d-%d *s1 != '/'../orig.origCannot back up %s as %s: %s %d; URL=%sto - newname == fsqlen%s: %s: Not enough memory. mallocreallocstrdup%02d:%02d:%02d%04d-%02d-%02d %02d:%02d:%02dwget-logforkContinuing in background. Output will be written to `%s'. utime(%s): %s Unlinking %s (symlink). Failed to unlink symlink `%s': %s %s.%d11.8 @<000<0H0T0`0l0x00000000000000 0,080D0P0\0h0t0000000000000~0{0x(0u40r@0oL0lX0id0fp0c|0`0]0Z0W0T0Q0N0K0H0E0B0? 0<09$06003<00H0-T0*`0'l0$x0!0000000 0 00000 0,080D0P0\0h0t000000000000000(040@0L0X0d0p0|0.: ( (%\ D < odo6oX7<7 oo8,++++++:P:@;X;P;H;@;8;0;(; ;;;;============;X;P;H;@;8;0;(; ;;;;AABEACEACTADADAADDAGOAIDAIMAIRALLALPAMAMYANANAANDANNANTANYAPEAPSAPTARCAREARKARMARTASASHASKATATEAUGAUKAVEAWEAWKAWLAWNAXAYEBADBAGBAHBAMBANBARBATBAYBEBEDBEEBEGBENBETBEYBIBBIDBIGBINBITBOBBOGBONBOOBOPBOWBOYBUBBUDBUGBUMBUNBUSBUTBUYBYBYECABCALCAMCANCAPCARCATCAWCODCOGCOLCONCOOCOPCOTCOWCOYCRYCUBCUECUPCURCUTDABDADDAMDANDARDAYDEEDELDENDESDEWDIDDIEDIGDINDIPDODOEDOGDONDOTDOWDRYDUBDUDDUEDUGDUNEAREATEDEELEGGEGOELIELKELMELYEMENDESTETCEVAEVEEWEEYEFADFANFARFATFAYFEDFEEFEWFIBFIGFINFIRFITFLOFLYFOEFOGFORFRYFUMFUNFURGABGADGAGGALGAMGAPGASGAYGEEGELGEMGETGIGGILGINGOGOTGUMGUNGUSGUTGUYGYMGYPHAHADHALHAMHANHAPHASHATHAWHAYHEHEMHENHERHEWHEYHIHIDHIMHIPHISHITHOHOBHOCHOEHOGHOPHOTHOWHUBHUEHUGHUHHUMHUTIICYIDAIFIKEILLINKINNIOIONIQIRAIREIRKISITITSIVYJABJAGJAMJANJARJAWJAYJETJIGJIMJOJOBJOEJOGJOTJOYJUGJUTKAYKEGKENKEYKIDKIMKINKITLALABLACLADLAGLAMLAPLAWLAYLEALEDLEELEGLENLEOLETLEWLIDLIELINLIPLITLOLOBLOGLOPLOSLOTLOULOWLOYLUGLYEMAMACMADMAEMANMAOMAPMATMAWMAYMEMEGMELMENMETMEWMIDMINMITMOBMODMOEMOOMOPMOSMOTMOWMUDMUGMUMMYNABNAGNANNAPNATNAYNENEDNEENETNEWNIBNILNIPNITNONOBNODNONNORNOTNOVNOWNUNUNNUTOOAFOAKOAROATODDODEOFOFFOFTOHOILOKOLDONONEORORBOREORROSOTTOUROUTOVAOWOWEOWLOWNOXPAPADPALPAMPANPAPPARPATPAWPAYPEAPEGPENPEPPERPETPEWPHIPIPIEPINPITPLYPOPODPOEPOPPOTPOWPROPRYPUBPUGPUNPUPPUTQUORAGRAMRANRAPRATRAWRAYREBREDREPRETRIBRIDRIGRIMRIORIPROBRODROERONROTROWROYRUBRUERUGRUMRUNRYESACSADSAGSALSAMSANSAPSATSAWSAYSEASECSEESENSETSEWSHESHYSINSIPSIRSISSITSKISKYSLYSOSOBSODSONSOPSOWSOYSPASPYSUBSUDSUESUMSUNSUPTABTADTAGTANTAPTARTEATEDTEETENTHETHYTICTIETIMTINTIPTOTOETOGTOMTONTOOTOPTOWTOYTRYTUBTUGTUMTUNTWOUNUPUSUSEVANVATVETVIEWADWAGWARWASWAYWEWEBWEDWEEWETWHOWHYWINWITWOKWONWOOWOWWRYWUYAMYAPYAWYEYEAYESYETYOUABEDABELABETABLEABUTACHEACIDACMEACREACTAACTSADAMADDSADENAFARAFROAGEEAHEMAHOYAIDAAIDEAIDSAIRYAJARAKINALANALECALGAALIAALLYALMAALOEALSOALTOALUMALVAAMENAMESAMIDAMMOAMOKAMOSAMRAANDYANEWANNAANNEANTEANTIAQUAARABARCHAREAARGOARIDARMYARTSARTYASIAASKSATOMAUNTAURAAUTOAVERAVIDAVISAVONAVOWAWAYAWRYBABEBABYBACHBACKBADEBAILBAITBAKEBALDBALEBALIBALKBALLBALMBANDBANEBANGBANKBARBBARDBAREBARKBARNBARRBASEBASHBASKBASSBATEBATHBAWDBAWLBEADBEAKBEAMBEANBEARBEATBEAUBECKBEEFBEENBEERBEETBELABELLBELTBENDBENTBERGBERNBERTBESSBESTBETABETHBHOYBIASBIDEBIENBILEBILKBILLBINDBINGBIRDBITEBITSBLABBLATBLEDBLEWBLOBBLOCBLOTBLOWBLUEBLUMBLURBOARBOATBOCABOCKBODEBODYBOGYBOHRBOILBOLDBOLOBOLTBOMBBONABONDBONEBONGBONNBONYBOOKBOOMBOONBOOTBOREBORGBORNBOSEBOSSBOTHBOUTBOWLBOYDBRADBRAEBRAGBRANBRAYBREDBREWBRIGBRIMBROWBUCKBUDDBUFFBULBBULKBULLBUNKBUNTBUOYBURGBURLBURNBURRBURTBURYBUSHBUSSBUSTBUSYBYTECADYCAFECAGECAINCAKECALFCALLCALMCAMECANECANTCARDCARECARLCARRCARTCASECASHCASKCASTCAVECEILCELLCENTCERNCHADCHARCHATCHAWCHEFCHENCHEWCHICCHINCHOUCHOWCHUBCHUGCHUMCITECITYCLADCLAMCLANCLAWCLAYCLODCLOGCLOTCLUBCLUECOALCOATCOCACOCKCOCOCODACODECODYCOEDCOILCOINCOKECOLACOLDCOLTCOMACOMBCOMECOOKCOOLCOONCOOTCORDCORECORKCORNCOSTCOVECOWLCRABCRAGCRAMCRAYCREWCRIBCROWCRUDCUBACUBECUFFCULLCULTCUNYCURBCURDCURECURLCURTCUTSDADEDALEDAMEDANADANEDANGDANKDAREDARKDARNDARTDASHDATADATEDAVEDAVYDAWNDAYSDEADDEAFDEALDEANDEARDEBTDECKDEEDDEEMDEERDEFTDEFYDELLDENTDENYDESKDIALDICEDIEDDIETDIMEDINEDINGDINTDIREDIRTDISCDISHDISKDIVEDOCKDOESDOLEDOLLDOLTDOMEDONEDOOMDOORDORADOSEDOTEDOUGDOURDOVEDOWNDRABDRAGDRAMDRAWDREWDRUBDRUGDRUMDUALDUCKDUCTDUELDUETDUKEDULLDUMBDUNEDUNKDUSKDUSTDUTYEACHEARLEARNEASEEASTEASYEBENECHOEDDYEDENEDGEEDGYEDITEDNAEGANELANELBAELLAELSEEMILEMITEMMAENDSERICEROSEVENEVEREVILEYEDFACEFACTFADEFAILFAINFAIRFAKEFALLFAMEFANGFARMFASTFATEFAWNFEARFEATFEEDFEELFEETFELLFELTFENDFERNFESTFEUDFIEFFIGSFILEFILLFILMFINDFINEFINKFIREFIRMFISHFISKFISTFITSFIVEFLAGFLAKFLAMFLATFLAWFLEAFLEDFLEWFLITFLOCFLOGFLOWFLUBFLUEFOALFOAMFOGYFOILFOLDFOLKFONDFONTFOODFOOLFOOTFORDFOREFORKFORMFORTFOSSFOULFOURFOWLFRAUFRAYFREDFREEFRETFREYFROGFROMFUELFULLFUMEFUNDFUNKFURYFUSEFUSSGAFFGAGEGAILGAINGAITGALAGALEGALLGALTGAMEGANGGARBGARYGASHGATEGAULGAURGAVEGAWKGEARGELDGENEGENTGERMGETSGIBEGIFTGILDGILLGILTGINAGIRDGIRLGISTGIVEGLADGLEEGLENGLIBGLOBGLOMGLOWGLUEGLUMGLUTGOADGOALGOATGOERGOESGOLDGOLFGONEGONGGOODGOOFGOREGORYGOSHGOUTGOWNGRABGRADGRAYGREGGREWGREYGRIDGRIMGRINGRITGROWGRUBGULFGULLGUNKGURUGUSHGUSTGWENGWYNHAAGHAASHACKHAILHAIRHALEHALFHALLHALOHALTHANDHANGHANKHANSHARDHARKHARMHARTHASHHASTHATEHATHHAULHAVEHAWKHAYSHEADHEALHEARHEATHEBEHECKHEEDHEELHEFTHELDHELLHELMHERBHERDHEREHEROHERSHESSHEWNHICKHIDEHIGHHIKEHILLHILTHINDHINTHIREHISSHIVEHOBOHOCKHOFFHOLDHOLEHOLMHOLTHOMEHONEHONKHOODHOOFHOOKHOOTHORNHOSEHOSTHOURHOVEHOWEHOWLHOYTHUCKHUEDHUFFHUGEHUGHHUGOHULKHULLHUNKHUNTHURDHURLHURTHUSHHYDEHYMNIBISICONIDEAIDLEIFFYINCAINCHINTOIONSIOTAIOWAIRISIRMAIRONISLEITCHITEMIVANJACKJADEJAILJAKEJANEJAVAJEANJEFFJERKJESSJESTJIBEJILLJILTJIVEJOANJOBSJOCKJOELJOEYJOHNJOINJOKEJOLTJOVEJUDDJUDEJUDOJUDYJUJUJUKEJULYJUNEJUNKJUNOJURYJUSTJUTEKAHNKALEKANEKANTKARLKATEKEELKEENKENOKENTKERNKERRKEYSKICKKILLKINDKINGKIRKKISSKITEKLANKNEEKNEWKNITKNOBKNOTKNOWKOCHKONGKUDOKURDKURTKYLELACELACKLACYLADYLAIDLAINLAIRLAKELAMBLAMELANDLANELANGLARDLARKLASSLASTLATELAUDLAVALAWNLAWSLAYSLEADLEAFLEAKLEANLEARLEEKLEERLEFTLENDLENSLENTLEONLESKLESSLESTLETSLIARLICELICKLIEDLIENLIESLIEULIFELIFTLIKELILALILTLILYLIMALIMBLIMELINDLINELINKLINTLIONLISALISTLIVELOADLOAFLOAMLOANLOCKLOFTLOGELOISLOLALONELONGLOOKLOONLOOTLORDLORELOSELOSSLOSTLOUDLOVELOWELUCKLUCYLUGELUKELULULUNDLUNGLURALURELURKLUSHLUSTLYLELYNNLYONLYRAMACEMADEMAGIMAIDMAILMAINMAKEMALEMALIMALLMALTMANAMANNMANYMARCMAREMARKMARSMARTMARYMASHMASKMASSMASTMATEMATHMAULMAYOMEADMEALMEANMEATMEEKMEETMELDMELTMEMOMENDMENUMERTMESHMESSMICEMIKEMILDMILEMILKMILLMILTMIMIMINDMINEMINIMINKMINTMIREMISSMISTMITEMITTMOANMOATMOCKMODEMOLDMOLEMOLLMOLTMONAMONKMONTMOODMOONMOORMOOTMOREMORNMORTMOSSMOSTMOTHMOVEMUCHMUCKMUDDMUFFMULEMULLMURKMUSHMUSTMUTEMUTTMYRAMYTHNAGYNAILNAIRNAMENARYNASHNAVENAVYNEALNEARNEATNECKNEEDNEILNELLNEONNERONESSNESTNEWSNEWTNIBSNICENICKNILENINANINENOAHNODENOELNOLLNONENOOKNOONNORMNOSENOTENOUNNOVANUDENULLNUMBOATHOBEYOBOEODINOHIOOILYOINTOKAYOLAFOLDYOLGAOLINOMANOMENOMITONCEONESONLYONTOONUSORALORGYOSLOOTISOTTOOUCHOUSTOUTSOVALOVENOVEROWLYOWNSQUADQUITQUODRACERACKRACYRAFTRAGERAIDRAILRAINRAKERANKRANTRARERASHRATERAVERAYSREADREALREAMREARRECKREEDREEFREEKREELREIDREINRENARENDRENTRESTRICERICHRICKRIDERIFTRILLRIMERINGRINKRISERISKRITEROADROAMROARROBEROCKRODEROILROLLROMEROODROOFROOKROOMROOTROSAROSEROSSROSYROTHROUTROVEROWEROWSRUBERUBYRUDERUDYRUINRULERUNGRUNSRUNTRUSERUSHRUSKRUSSRUSTRUTHSACKSAFESAGESAIDSAILSALESALKSALTSAMESANDSANESANGSANKSARASAULSAVESAYSSCANSCARSCATSCOTSEALSEAMSEARSEATSEEDSEEKSEEMSEENSEESSELFSELLSENDSENTSETSSEWNSHAGSHAMSHAWSHAYSHEDSHIMSHINSHODSHOESHOTSHOWSHUNSHUTSICKSIDESIFTSIGHSIGNSILKSILLSILOSILTSINESINGSINKSIRESITESITSSITUSKATSKEWSKIDSKIMSKINSKITSLABSLAMSLATSLAYSLEDSLEWSLIDSLIMSLITSLOBSLOGSLOTSLOWSLUGSLUMSLURSMOGSMUGSNAGSNOBSNOWSNUBSNUGSOAKSOARSOCKSODASOFASOFTSOILSOLDSOMESONGSOONSOOTSORESORTSOULSOURSOWNSTABSTAGSTANSTARSTAYSTEMSTEWSTIRSTOWSTUBSTUNSUCHSUDSSUITSULKSUMSSUNGSUNKSURESURFSWABSWAGSWAMSWANSWATSWAYSWIMSWUMTACKTACTTAILTAKETALETALKTALLTANKTASKTATETAUTTEALTEAMTEARTECHTEEMTEENTEETTELLTENDTENTTERMTERNTESSTESTTHANTHATTHEETHEMTHENTHEYTHINTHISTHUDTHUGTICKTIDETIDYTIEDTIERTILETILLTILTTIMETINATINETINTTINYTIRETOADTOGOTOILTOLDTOLLTONETONGTONYTOOKTOOLTOOTTORETORNTOTETOURTOUTTOWNTRAGTRAMTRAYTREETREKTRIGTRIMTRIOTRODTROTTROYTRUETUBATUBETUCKTUFTTUNATUNETUNGTURFTURNTUSKTWIGTWINTWITULANUNITURGEUSEDUSERUSESUTAHVAILVAINVALEVARYVASEVASTVEALVEDAVEILVEINVENDVENTVERBVERYVETOVICEVIEWVINEVISEVOIDVOLTVOTEWACKWADEWAGEWAILWAITWAKEWALEWALKWALLWALTWANDWANEWANGWANTWARDWARMWARNWARTWASHWASTWATSWATTWAVEWAVYWAYSWEAKWEALWEANWEARWEEDWEEKWEIRWELDWELLWELTWENTWEREWERTWESTWHAMWHATWHEEWHENWHETWHOAWHOMWICKWIFEWILDWILLWINDWINEWINGWINKWINOWIREWISEWISHWITHWOLFWONTWOODWOOLWORDWOREWORKWORMWORNWOVEWRITWYNNYALEYANGYANKYARDYARNYAWLYAWNYEAHYEARYELLYOGAYOKE?FFFFFFFxFpFhF`FXFPFHF@F8F0F(F FFFFFFFFFF F F F F F FFFFFFGFFFQQQQABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/R0R(R W lZWPVWVV$VV0VV4X4VXVhU,VVVVV@VVlVVLX4V(VVp\VV`XYVP]VH|ZV8PZV(TX4VXX4VLXUtZPUZUVUZUdVUXUVU^HU`VUx_hUhVUXXUHXU8XU(XU,VUZTxZPT`YT(VTZTpYT\YTXT_TVTTVTx<VTpZT` XTPYT@dVT0VT(XTXTXSXSVSZSVS@XS`S<XSpZS8VSDVSxVSpVS`tYSP$VS@ VS04VS(hVS \pS,VS XRVR`tRVR\pR\psPbs8Ks(csksdsrrrxrxrFrhrErxrpmr`rPr8r(rrqqqpqqqqrqLqqxsqhSqXHqPq@Nq8vq0Vq(AqaqqBppCpppPpDppepXpxphp`gpXpPp@p0p GpIoiolooonoOooooYoopohQo`RoPoHTo@to0Uo(oYowo{0{DX<P} }}}(P X <%\677$7<< ( ( ( \  ,4<@ $@.2,@4N= d= s<= > = >$ >l >< >T >$  h> %> /> 7> B> LXSphlmwK\@ _8 ZD xhH tGD P` Z H -G <X, QLl eWl vG ~U I e ThL YL G Z,h I H$t *[( >Hh Wh _h iop  \ m m m  m <P o dl  m n  (4A P Z b n yĀ p   D   4dL   | ! +  =HĘ!O ^ a iф n xt < ֠ ָ <  0 ļ֠  B   '< 2  D NH` ak z     H   xX x ,9 H \ m u ht P T p  0x l  ("X + <T FDW^h qD l 0 Fh  x   Ex #C 1 ;Fh XB( h sH {, p|  B  H@ 8 ` l 0  T *K\ HLT b(` m<4   X0 P` XD ^H  Mp `` M4 \p NP M| `t| ]X /U, ;a WM$ bML j_l z` Md  V  ZP ZH M4 Vl M$ Y _h@ O -X4\ 8Zt B H Rf  ]bL kb` zb   ͤ c bx  b j$ b` dT   l$ l<L %k 4l >l$ Jk Rk ]| tk ~ l  H ` H     z@    , D "( -, 7ͨI [f nt {Ì(Dt (   ø< 0`    ôP & .< C N( \ͬi sXH ~ʹͰ 0  L ,    ͼ-$ ;x L T i͸yH t$  @  4@   '8 GPd Rh b, jȴ r |Dl X ͠ Ҡ, ͼ p    ͈ + ;X E  _lܔ {ܔ 4 Ll     h |   # 1D @0 O0 \ܔ k {  $   ܬ 4l <d  X    $H 8 ` Rfܔ pd   $`  X $   8  ,    + t 5 ? $ J D Rt i \ t , ~  $  < ' (@ <(H (@ ',5( @8M0ZaspD | tD ( 40 <t 'L  4D $  #`'` :, PUH8 b$ ry D ht   |E8 x8 |` dD %x- BK \$ jlq<l \ x@!4(  dX x 8     &x 5\ KX^$L m  x $  L <( 8 0 $ T <pl &%D` 8=0BpKh [g$D d( t (   mPX @ ` T8H PpX - < Jx U(] l( r {8H hP (h  8H \     !'| 5= Gt@ \bDt mHr`( ~! x O,d !( h   $| p0  g >x *5H D\ QlW dk@| xL  $ $( x8 $ @p  A, l +2h ?0@ I\Q \  g$ wb8(  l HP H    i4 t `[p Ch @ #-4 8 @( M 8 c4 q yH( p dW0  $  , ` ' / 9< AP J( X$@ h5@  rk M ( \ h    8 4x h !T  !p, ! !20 !=|!!E!L!R !a!g !p,!wT!~fp !D !t !8!h !!R !!T !!` !, """X"!D "*t "7D, "C@ "R "`h8 "x"} | """ "d"""t "ghP ""@X "4 #\ ##!4 #"#/@#6#P8 #i#o#y|#l0 #x #B  #|  # ( #  ##\ #e( #x # $< $ P $ $5_ $Bp $W $_$f( $v\ $}, $( $'H $$ $id $( $$$( $D %p %D %4%$@< %0H %7m( %<8 %ED%N%Y0X %j$$ %L%(%%%T4 %R %h %%ΰ\ %T %L&8 & &!&(&2T &> &CH &R( &b@&k| &y( &F &<X &?d &hX8 &&h &&&ш &ED &H &'Ah '%< '*F '1 wgetcrti.svalues-Xa.ccrtstuff.cobject.11p.3__CTOR_LIST____DTOR_LIST____do_global_dtors_auxgcc2_compiled.__EH_FRAME_BEGIN__force_to_datafini_dummyinit_dummycompleted.4frame_dummycmpt.cgcc2_compiled.ttyname_rctime_rgetlogin_rasctime_rconnect.cres.40msockgcc2_compiled.ttyname_rctime_rgetlogin_rasctime_rsrv.27connection_host_nameaddrcookies.cdiscard_matching_cookiedomain_portequality_comparatorcookies_nowdelete_cookie_chain_mappercookies_hash_tablecookie_newparse_set_cookieseliminate_dupsfind_cookie_chain_exactgcc2_compiled.find_matching_chainsupdate_cookie_fieldcheck_path_matchctime_rcheck_domain_matchstore_cookiesave_cookies_mappernumeric_address_ppath_matchesasctime_rmatching_cookiespecial_toplevel_domains.36find_matching_cookiedelete_cookiegoodness_comparatorfnmatch.cgcc2_compiled.ctime_rasctime_rftp.cftp_loop_internaldepth.27ftp_retrieve_dirsdelelementgcc2_compiled.ttyname_rctime_rftp_retrieve_globgetlogin_rfreefileinfogetftpftp_retrieve_listasctime_rftp_expected_bytesftp-basic.cskey_head.21gcc2_compiled.ttyname_rctime_rftp_requestgetlogin_rnumbuf.37asctime_rftp-ls.cftp_parse_winnt_lsgcc2_compiled.ttyname_rvmspermssympermsctime_rmonths.31months.38months.21ftp_parse_vms_lsgetlogin_rclean_lineasctime_rftp_parse_unix_lsftp-opie.cbuf.15gcc2_compiled.Wpctime_rbtoeasctime_rextractgetopt.cmy_indexgcc2_compiled.ctime_rexchangemy_bcopynextcharasctime_rfirst_nonoptorderinglast_nonopthash.cgcc2_compiled.primes.9grow_hash_tablectime_rprime_sizestring_cmp_nocaseasctime_rstring_hash_nocaseheaders.cgcc2_compiled.ctime_rasctime_rhost.caddress_list_deletegcc2_compiled.host_name_addresses_mapaddress_list_newhost_cleanup_mapperctime_rasctime_raddress_list_new_onecache_host_lookuphtml-parse.cgcc2_compiled.advance_declarationconvert_and_copyctime_rasctime_rarray_allowedhtml-url.chandle_linkgcc2_compiled.find_attrknown_tagscollect_tags_mapperctime_rinteresting_attributesinteresting_tagsadditional_attributesfind_taginit_interestingasctime_rurl_tag_attr_maphttp.chttp_process_rangebasic_authentication_encodepc_last_host_ipregister_persistentgcc2_compiled.dump_hashpc_last_portparse_http_status_linettyname_rpc_active_poptions.74extract_header_attrbase64_encodeopaque.72digest_authentication_encodemktime_from_utcpc_last_fdctime_rhttp_process_connectionhttp_process_typegethttpcheck_endnonce.73tbl.58time_formats.54getlogin_rpersistent_available_pasctime_rcookies_loaded_pinvalidate_persistentknown_authentication_scheme_pcreate_authorization_linefree_hstathttp_process_nonerealm.71init.ccmd_stringrun_wgetrccmd_number_infcmd_spec_headercomindcmd_spec_recursivegcc2_compiled.cmd_timedefaultsttyname_rcmd_spec_useragentcmd_spec_dirstructcmd_addresscheck_user_specified_headergetpwnam_rctime_rcmd_spec_mirrormyatoigetlogin_renable_tilde_expansioncmd_booleancommandscmd_directory_vectorcmd_vectorasctime_rcmd_lockable_booleangetpwuid_rcmd_filecmd_spec_htmlifywgetrc_file_namecmd_numbercmd_byteslog.clog_lineslogvprintffree_log_linegcc2_compiled.ttyname_rflush_log_plogfptrailing_linesaved_append_1ctime_rlog_line_currentgetlogin_rlog_dumpasctime_rsaved_appendneeds_flushingmain.csigwaiti18n_initializegcc2_compiled.ttyname_rprint_usagectime_rgetlogin_rredirect_output_signalasctime_rlong_options.27print_helpgen-md5.cgcc2_compiled.ctime_rasctime_rgnu-md5.cgcc2_compiled.ctime_rasctime_rfillbufnetrc.cparse_netrcgcc2_compiled.ctime_rshift_leftasctime_rprocessed_netrc.9maybe_add_to_listprogress.csigwaitcreate_imageimplementationsbar_createdot_set_paramsdot_finishgcc2_compiled.short_units.63bar_set_paramsdot_updatettyname_rdot_createbar_updatescreen_widthprint_percentagectime_rprint_download_speedgetlogin_rdisplay_imagecurrent_implasctime_rbar_finishoutput_redirectedcurrent_impl_lockedrbuf.cgcc2_compiled.ctime_rasctime_rrecur.cdescend_redirect_purl_queue_deletegcc2_compiled.url_dequeuettyname_rdl_url_file_mapurl_queue_newdownload_child_pctime_rregister_delete_filedl_file_url_mapdownloaded_html_filesmatch_except_indexdissociate_urls_from_filegetlogin_rurl_enqueueasctime_rdissociate_urls_from_file_mapperres.ccleanup_hash_table_mapperadd_pathregistered_specsgcc2_compiled.free_specsprune_non_exactctime_rmatchesasctime_rmatch_user_agentretr.cres.25first_retrieval.54gcc2_compiled.ttyname_rregister_redirections_mapperlimit_bandwidth_resetctime_rlimit_datarate_names.26c.21getlogin_rlimit_bandwidthasctime_rregister_all_redirectionssafe-ctype.cgcc2_compiled.snprintf.cgcc2_compiled.url.ccount_slashesrewritten_storage.129mkstructv1.158df_free_mappercompose_file_namefind_fragmentwrite_backup_fileparse_unamev2.159decode_stringfind_last_charstrpbrk_or_eosurlchr_tablegcc2_compiled.full_path_writettyname_rparse_errorsv3.160downloaded_files_hashv4.161parse_pathlocal_quote_stringctime_rconstruct_relativefull_path_lengthuri_merge_1replace_attrgetlogin_rencode_string_maybereplace_attr_refresh_hackconverted_files.142asctime_rreencode_stringurlpath_lengthlowercase_strdownloaded_mode_to_ptrsupported_schemessync_pathutils.cfree_keys_and_values_mappermemfatalgcc2_compiled.outbuf.152very_long_to_stringttyname_rlegible_1getpwnam_rctime_rstring_set_free_mappergetlogin_rasctime_rproclistgetpwuid_routput.45output.49unique_name_1in_acclistversion.cgcc2_compiled.libgcc2.cLetextcrtstuff.c__FRAME_END____do_global_ctors_auxgcc2_compiled.force_to_datainit_dummy__DTOR_END____CTOR_END__crtn.s__posix_asctime_rfrontcmpurl_freeurl_errorgetoptregister_htmlftp_last_respline_startdetermine_screen_widthmd5_process_bytesreadgmtimeselect_fdwtimer_newrbuf_read_bufferful_START_optretrieve_from_filerewrite_shorthand_urlatoihost_cleanupwtimer_allocaterewindrbuf_discardcleanup_html_urlstrtokstrtolmkalldirsgetpwuidcloseportglobal_download_countftp_listvfprintf_environ_endprogress_schedule_redirectconvert_all_linksmemmoveregister_redirection__urem64hash_table_countwtimer_deletestrduphash_table_newstring_set_containsfork_iobunique_name__register_frame_infoget_urls_filegen_md5_context_size__posix_ctime_rretrieve_tree__flsbuf_sch_touppergen_md5_finishres_match_path_GLOBAL_OFFSET_TABLE___posix_getpwuid_rwtimer_elapsedstring_cmpurl_stringsleepremove_linkcount_charencode_stringslist_freeabortgethostbynamelegiblemkdirsetvalsignalacceptstrcasecmpdownloaded_increase__posix_sigwaitatexithtml_quote_stringexitrandstrerrordebug_logprintflogflushstring_set_free__posix_ttyname_rxstrdup_realurl_skip_schemeoptoptusleephas_wildcards_pmd5_init_ctxdownloaded_exceeds_quotaaccessmallocskip_lwssprintfbindtextdomainsymlinkprogress_createhash_table_getheader_strduprbuf_flushgettextgen_md5_update_initftp_pasvaddress_list_match_alltouchfwritemd5_process_blocktextdomain__udiv64xrealloc_realmake_directorysetsockoptmd5_finish_ctxexec_name.umulfree_keys_and_valuesfputsaccept_domainh_errnourl_parsefile_non_directory_p.uremfree_netrctimeurl_set_dirlong_to_string.remhash_table_removehome_dirlegible_very_longres_parsescheme_disablesscanfftp_retrgetuidno_proxy_matchftp_restlogprintfset_connection_host_namesave_log_pslist_containssearch_netrcqsortgen_md5_initfcloseurl_filenamegetenv_END_free_vec_getopt_internalhash_table_clearwtimer_reseturi_mergemunmapmake_nocase_string_hash_tableselect__xnet_bindsepstringconnect_to_manyrecursive_cleanupmktimeslist_appendprintwhatstrncpyacceptablemerge_vecsprogress_finishcleanup_DYNAMICrbuf_peekrenamegetproxyrbuf_initialize_sch_tolowerlog_initaddress_list_copy_onestrncmpbuild_cookies_requesthttp_atotmprintf__iobheader_processsetlocalefilenores_cleanupurl_set_filedownloaded_files_freeconvert_linksftp_cwdslist_prependstrcatstrncasecmpioctlres_retrieve_file__posix_getpwnam_rset_cookie_header_cbinet_addrwriteftp_responseaddress_list_set_faultydownloaded_filereallocstrrchrvsnprintfstrpbrkftp_systheader_existsftp_get_listinghttp_loopredirect_outputhttp_cleanuppretty_print_addressfnmatchheader_get_sch_istableftp_parse_lsvalid_progress_implementation_pmatch_tail_exitfile_exists_pslist_nreversehash_table_destroyurl_schemeenvironperrorsrandhash_table_puterrnoftp_loopunlinkstrchrsave_cookiesacceptportfile_mergelstathash_table_get_pairinet_ntoainitializeutimeregister_downloadfreesuffixhash_table_containsoptindgetsocknamecloseftp_typeretrieve_urlstrdupdelimstring_set_addmap_html_tagscalculate_skey_responseopenretr_rateoptargfgetc__deregister_frame_info___errnostrcmpfgetsheader_extract_numberlog_set_flushopterrurl_has_schemeftp_indexfree_urlposmemchrnumdigitgettimeofday_edata_PROCEDURE_LINKAGE_TABLE_progress_handle_sigwinchfopenftruncatememsetftp_portpath_simplifybindportrbuf_uninitializexmalloc_realscheme_default_portmmaptime_strlogputsdatetime_strread_fileread_file_freexstrdup_loweraddress_list_get_boundsload_cookiesaddress_list_releaseasctimestrcpyread_whole_line_etextres_register_specs_lib_version__eprintffflushsufmatchlog_closehash_table_mapmemcmp__posix_getlogin_rgetopt_longget_urls_htmlftp_loginftp_pwd__xnet_socketlookup_hostaccdirmainftp_sizereadlinknetrc_listftp_process_typemake_string_hash_table.divversion_stringchmodmemcpyurl_full_pathparse_lineres_parse_from_filestrlenget_contentsfork_to_background__xnet_connectmd5_read_ctxrotate_backupsstrstrlocaltimestring_hashstaturl_skip_unameprogress_updatestrptimeres_get_specs_finiireadsleep_between_retrievalsconnect_to_onecookies_cleanuplistenrbuf_initialized_pfstatfprintfcalc_rateconaddrherrmsgisattytest_socket_openwtimer_granularityiwriteset_progress_implementationas: WorkShop Compilers 4.X dev 18 Sep 1996 as: WorkShop Compilers 4.X dev 18 Sep 1996 @(#)SunOS 5.7 Generic October 1998as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 5.0 Alpha 03/27/98 Build GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 GCC: (GNU) 2.95.1 19990816 (release)as: WorkShop Compilers 4.X dev 18 Sep 1996 ld: Software Generation Utilities - Solaris-ELF (4.0)q <I4( d'#d'B<Q΀Cۀ+Qv̀(Lv 6;h2Nƀrɂ=St %+ #0 85 LB b x ʀ ! " Y# p' > D ΀E J N O (P ?U V^ n_ n o w Հ} ~  , J h - . ؀> ? @ A 1C OD eE zG H I J րW \ab1cLdglmnoԀu(AZugɀ&>Wpˀ$=Z%J-o5Ӏ<<ESKiPUZ`ǀa݀bc5LawÂ݂1wՀ,GՀ΀ .Ff&@!R!'!€"P/"l"""$""C##"#B#d%%%%˂%܀v%& X& Y&5Z&K[&`\&v^&_&e&h&Ѐ''?'T'o,','E'J'р(L$'(^@(m@(@(@($H(d(@.interp.hash.dynsym.dynstr.SUNW_version.rela.got.rela.bss.rela.plt.text.init.fini.rodata.got.plt.dynamic.data.ctors.dtors.eh_frame.bss.symtab.strtab.comment.stab.index.stab.shstrtab.stab.indexstr.stabstrvalues-Xa.cXt ; O ; V=3.1 ; R=WorkShop Compilers 4.2 30 Oct 1996 C 4.2/builds3/s998_21a/usr/src/lib/libc/sparc; /opt/SUNWspro.40/SC4.2/bin/../SC4.2/bin/cc -xO3 -xcg89 -Wa,-cg92 -xspace -W0,-Lt -Xt -D_REENTRANT -Dsparc -Iinc -I../inc -DTEXT_DOMAIN='"SUNW_OST_OSLIB"' -I/builds3/s998_21a/proto/root_sparc/usr/include -c -o values-Xa.o ../port/gen/values-Xa.c -W0,-xplibgcc2.c/devel/src/gcc_dir/gcc/../../gcc-2.95.1/gcc/libgcc2.cgcc2_compiled.int:t(0,1)=r(0,1);0020000000000;0017777777777;char:t(0,2)=r(0,2);0;127;long int:t(0,3)=r(0,1);0020000000000;0017777777777;unsigned int:t(0,4)=r(0,1);0000000000000;0037777777777;long unsigned int:t(0,5)=r(0,1);0000000000000;0037777777777;long long int:t(0,6)=r(0,1);01000000000000000000000;0777777777777777777777;long long unsigned int:t(0,7)=r(0,1);0000000000000;01777777777777777777777;short int:t(0,8)=r(0,8);-32768;32767;short unsigned int:t(0,9)=r(0,9);0;65535;signed char:t(0,10)=r(0,10);-128;127;unsigned char:t(0,11)=r(0,11);0;255;float:t(0,12)=r(0,1);4;0;double:t(0,13)=r(0,1);8;0;long double:t(0,14)=r(0,1);16;0;complex int:t(0,15)=s8real:(0,1),0,32;imag:(0,1),32,32;;complex float:t(0,16)=r(0,16);4;0;complex double:t(0,17)=r(0,17);8;0;complex long double:t(0,18)=r(0,18);16;0;void:t(0,19)=(0,19)tconfig.h../../gcc-2.95.1/gcc/gansidecl.h../../gcc-2.95.1/gcc/../include/ansidecl.h../../gcc-2.95.1/gcc/config/xm-siglist.h../../gcc-2.95.1/gcc/config/sparc/xm-sysv4.htm.h../../gcc-2.95.1/gcc/config/sparc/sol2-sld.h../../gcc-2.95.1/gcc/config/sparc/sol2.h../../gcc-2.95.1/gcc/config/sparc/sysv4.h../../gcc-2.95.1/gcc/config/sparc/sparc.hcmodel:T(10,1)=eCM_32:0,CM_MEDLOW:1,CM_MEDMID:2,CM_MEDANY:3,CM_EMBMEDANY:4,;processor_type:T(10,2)=ePROCESSOR_V7:0,PROCESSOR_CYPRESS:1,PROCESSOR_V8:2,PROCESSOR_SUPERSPARC:3,PROCESSOR_SPARCLITE:4,PROCESSOR_F930:5,PROCESSOR_F934:6,PROCESSOR_HYPERSPARC:7,PROCESSOR_SPARCLITE86X:8,PROCESSOR_SPARCLET:9,PROCESSOR_TSC701:10,PROCESSOR_V9:11,PROCESSOR_ULTRASPARC:12,;sparc_cpu_select:T(10,3)=s16string:(10,4)=*(0,2),0,32;name:(10,4),32,32;set_tune_p:(0,1),64,32;set_arch_p:(0,1),96,32;;reg_class:T(10,5)=eNO_REGS:0,FPCC_REGS:1,I64_REGS:2,GENERAL_REGS:3,FP_REGS:4,EXTRA_FP_REGS:5,GENERAL_OR_FP_REGS:6,GENERAL_OR_EXTRA_FP_REGS:7,ALL_REGS:8,LIM_REG_CLASSES:9,;sparc_args:T(10,6)=s12words:(0,1),0,32;prototype_p:(0,1),32,32;libcall_p:(0,1),64,32;;../../gcc-2.95.1/gcc/config/svr4.h../../gcc-2.95.1/gcc/config/dbxelf.h../../gcc-2.95.1/gcc/config/sparc/xm-sol2.h/usr/include/stdlib.h/usr/include/sys/feature_tests.hdiv_t:t(14,1)=(14,2)=s8quot:(0,1),0,32;rem:(0,1),32,32;;ldiv_t:t(14,3)=(14,4)=s8quot:(0,3),0,32;rem:(0,3),32,32;;lldiv_t:t(14,5)=(14,6)=s16quot:(0,6),0,64;rem:(0,6),64,64;;size_t:t(14,7)=(0,4)uid_t:t(14,8)=(0,3)wchar_t:t(14,9)=(0,3)/usr/include/unistd.h/usr/include/sys/types.h/usr/include/sys/isa_defs.h/usr/include/sys/machtypes.h_physadr_t:T(19,1)=s4r:(19,2)=ar(0,1);0;0;(0,1),0,32;;physadr_t:t(19,3)=(19,4)=*(19,1)_label_t:T(19,5)=s8val:(19,6)=ar(0,1);0;1;(0,1),0,64;;label_t:t(19,7)=(19,5)lock_t:t(19,8)=(0,11)/usr/include/sys/int_types.hint8_t:t(20,1)=(0,2)int16_t:t(20,2)=(0,8)int32_t:t(20,3)=(0,1)int64_t:t(20,4)=(0,6)uint8_t:t(20,5)=(0,11)uint16_t:t(20,6)=(0,9)uint32_t:t(20,7)=(0,4)uint64_t:t(20,8)=(0,7)intmax_t:t(20,9)=(20,4)uintmax_t:t(20,10)=(20,8)intptr_t:t(20,11)=(0,1)uintptr_t:t(20,12)=(0,4)int_least8_t:t(20,13)=(0,2)int_least16_t:t(20,14)=(0,8)int_least32_t:t(20,15)=(0,1)int_least64_t:t(20,16)=(0,6)uint_least8_t:t(20,17)=(0,11)uint_least16_t:t(20,18)=(0,9)uint_least32_t:t(20,19)=(0,4)uint_least64_t:t(20,20)=(0,7)longlong_t:t(17,1)=(0,6)u_longlong_t:t(17,2)=(0,7)uchar_t:t(17,3)=(0,11)ushort_t:t(17,4)=(0,9)uint_t:t(17,5)=(0,4)ulong_t:t(17,6)=(0,5)caddr_t:t(17,7)=(17,8)=*(0,2)daddr_t:t(17,9)=(0,3)cnt_t:t(17,10)=(0,8)paddr_t:t(17,11)=(17,6)use_t:t(17,12)=(17,3)sysid_t:t(17,13)=(0,8)index_t:t(17,14)=(0,8)off_t:t(17,15)=(0,3)off64_t:t(17,16)=(17,1)ino_t:t(17,17)=(17,6)blkcnt_t:t(17,18)=(0,3)fsblkcnt_t:t(17,19)=(17,6)fsfilcnt_t:t(17,20)=(17,6)ino64_t:t(17,21)=(17,2)blkcnt64_t:t(17,22)=(17,1)fsblkcnt64_t:t(17,23)=(17,2)fsfilcnt64_t:t(17,24)=(17,2) :T(17,25)=eB_FALSE:0,B_TRUE:1,;boolean_t:t(17,26)=(17,25)pad64_t:t(17,27)=(20,4)upad64_t:t(17,28)=(20,8)offset_t:t(17,29)=(17,1)u_offset_t:t(17,30)=(17,2)len_t:t(17,31)=(17,2)diskaddr_t:t(17,32)=(17,1)lloff_t:t(17,33)=(17,34)=u8_f:(17,29),0,64;_p:(17,35)=s8_u:(0,3),0,32;_l:(17,15),32,32;;,0,64;;lldaddr_t:t(17,36)=(17,37)=u8_f:(17,32),0,64;_p:(17,38)=s8_u:(0,3),0,32;_l:(17,9),32,32;;,0,64;;k_fltset_t:t(17,39)=(17,6)id_t:t(17,40)=(0,3)useconds_t:t(17,41)=(17,5)major_t:t(17,42)=(17,6)minor_t:t(17,43)=(17,6)pri_t:t(17,44)=(0,8)o_mode_t:t(17,45)=(17,4)o_dev_t:t(17,46)=(0,8)o_uid_t:t(17,47)=(17,4)o_gid_t:t(17,48)=(17,47)o_nlink_t:t(17,49)=(0,8)o_pid_t:t(17,50)=(0,8)o_ino_t:t(17,51)=(17,4)key_t:t(17,52)=(0,1)mode_t:t(17,53)=(17,6)gid_t:t(17,54)=(14,8)nlink_t:t(17,55)=(17,6)dev_t:t(17,56)=(17,6)pid_t:t(17,57)=(0,3)pthread_t:t(17,58)=(0,4)pthread_key_t:t(17,59)=(0,4)_pthread_mutex:T(17,60)=s24__pthread_mutex_flags:(17,61)=s8__pthread_mutex_flag:(17,62)=ar(0,1);0;3;(20,5),0,32;__pthread_mutex_type:(20,7),32,32;;,0,64;__pthread_mutex_lock:(17,63)=u8__pthread_mutex_lock64:(17,64)=s8__pthread_mutex_pad:(17,65)=ar(0,1);0;7;(20,5),0,64;;,0,64;__pthread_mutex_owner64:(17,28),0,64;;,64,64;__pthread_mutex_data:(17,28),128,64;;pthread_mutex_t:t(17,66)=(17,60)_pthread_cond:T(17,67)=s16__pthread_cond_flags:(17,68)=s8__pthread_cond_flag:(17,62),0,32;__pthread_cond_type:(20,7),32,32;;,0,64;__pthread_cond_data:(17,28),64,64;;pthread_cond_t:t(17,69)=(17,67)_pthread_attr:T(17,70)=s4__pthread_attrp:(17,71)=*(0,19),0,32;;pthread_attr_t:t(17,72)=(17,70)_pthread_mutexattr:T(17,73)=s4__pthread_mutexattrp:(17,71),0,32;;pthread_mutexattr_t:t(17,74)=(17,73)_pthread_condattr:T(17,75)=s4__pthread_condattrp:(17,71),0,32;;pthread_condattr_t:t(17,76)=(17,75)_once:T(17,77)=s32__pthread_once_pad:(17,78)=ar(0,1);0;3;(17,28),0,256;;pthread_once_t:t(17,79)=(17,77)ssize_t:t(17,80)=(0,1)time_t:t(17,81)=(0,3)clock_t:t(17,82)=(0,3)clockid_t:t(17,83)=(0,1)timer_t:t(17,84)=(0,1)unchar:t(17,85)=(0,11)ushort:t(17,86)=(0,9)uint:t(17,87)=(0,4)ulong:t(17,88)=(0,5)hostid_t:t(17,89)=(0,3)u_char:t(17,90)=(0,11)u_short:t(17,91)=(0,9)u_int:t(17,92)=(0,4)u_long:t(17,93)=(0,5)_quad:T(17,94)=s8val:(17,95)=ar(0,1);0;1;(0,3),0,64;;quad:t(17,96)=(17,94)/usr/include/sys/select.h/usr/include/sys/time.htimeval:T(22,1)=s8tv_sec:(17,81),0,32;tv_usec:(0,3),32,32;;timezone:T(22,2)=s8tz_minuteswest:(0,1),0,32;tz_dsttime:(0,1),32,32;;/usr/include/sys/types.hitimerval:T(22,3)=s16it_interval:(22,1),0,64;it_value:(22,1),64,64;;timespec:T(22,4)=s8tv_sec:(17,81),0,32;tv_nsec:(0,3),32,32;;timespec_t:t(22,5)=(22,4)timestruc_t:t(22,6)=(22,4)itimerspec:T(22,7)=s16it_interval:(22,4),0,64;it_value:(22,4),64,64;;itimerspec_t:t(22,8)=(22,7)hrtime_t:t(22,9)=(17,1)/usr/include/time.htm:T(24,1)=s36tm_sec:(0,1),0,32;tm_min:(0,1),32,32;tm_hour:(0,1),64,32;tm_mday:(0,1),96,32;tm_mon:(0,1),128,32;tm_year:(0,1),160,32;tm_wday:(0,1),192,32;tm_yday:(0,1),224,32;tm_isdst:(0,1),256,32;;/usr/include/sys/time.h/usr/include/sys/siginfo.hsigval:T(26,1)=u4sival_int:(0,1),0,32;sival_ptr:(17,71),0,32;;sigevent:T(26,2)=s24sigev_notify:(0,1),0,32;_sigev_un:(26,3)=u4_sigev_signo:(0,1),0,32;_sigev_notify_function:(26,4)=*(26,5)=f(0,19),0,32;;,32,32;sigev_value:(26,1),64,32;_sigev_pad1:(0,1),96,32;_sigev_notify_attributes:(17,71),128,32;_sigev_pad2:(0,1),160,32;;/usr/include/sys/machsig.h/usr/include/sys/time.hsiginfo:T(26,6)=s128si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(26,7)=u116__pad:(26,8)=ar(0,1);0;28;(0,1),0,928;__proc:(26,9)=s16__pid:(17,57),0,32;__pdata:(26,10)=u12__kill:(26,11)=s8__uid:(14,8),0,32;__value:(26,1),32,32;;,0,64;__cld:(26,12)=s12__utime:(17,82),0,32;__status:(0,1),32,32;__stime:(17,82),64,32;;,0,96;;,32,96;;,0,128;__fault:(26,13)=s12__addr:(17,71),0,32;__trapno:(0,1),32,32;__pc:(17,7),64,32;;,0,96;__file:(26,14)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(26,15)=s116__faddr:(17,7),0,32;\__tstamp:(22,6),32,64;__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;__sysarg:(26,16)=ar(0,1);0;7;(0,3),128,256;__mstate:(26,17)=ar(0,1);0;16;(0,3),384,544;;,0,928;;,96,928;;siginfo_t:t(26,18)=(26,6)k_siginfo:T(26,19)=s28si_signo:(0,1),0,32;si_code:(0,1),32,32;si_errno:(0,1),64,32;__data:(26,20)=u16__proc:(26,21)=s16__pid:(17,57),0,32;__pdata:(26,22)=u12__kill:(26,23)=s8__uid:(14,8),0,32;__value:(26,1),32,32;;,0,64;__cld:(26,24)=s12__utime:(17,82),0,32;__status:(0,1),32,32;__stime:(17,82),64,32;;,0,96;;,32,96;;,0,128;__fault:(26,25)=s12__addr:(17,71),0,32;__trapno:(0,1),32,32;__pc:(17,7),64,32;;,0,96;__file:(26,26)=s8__fd:(0,1),0,32;__band:(0,3),32,32;;,0,64;__prof:(26,27)=s16__faddr:(17,7),0,32;__tstamp:(22,6),32,64;\__syscall:(0,8),96,16;__nsysarg:(0,2),112,8;__fault:(0,2),120,8;;,0,128;;,96,128;;k_siginfo_t:t(26,28)=(26,19)sigqueue:T(26,29)=s40sq_next:(26,30)=*(26,29),0,32;sq_info:(26,28),32,224;sq_func:(26,31)=*(26,32)=f(0,19),256,32;sq_backptr:(17,71),288,32;;sigqueue_t:t(26,33)=(26,29)/usr/include/sys/select.hfd_mask:t(21,1)=(0,3)fds_mask:t(21,2)=(0,3)fd_set:T(21,3)=s128fds_bits:(21,4)=ar(0,1);0;31;(0,3),0,1024;;fd_set:t(21,5)=(21,3)/usr/include/sys/unistd.h../../gcc-2.95.1/gcc/machmode.h../../gcc-2.95.1/gcc/machmode.defmachine_mode:T(31,1)=eVOIDmode:0,PQImode:1,QImode:2,PHImode:3,HImode:4,PSImode:5,SImode:6,PDImode:7,DImode:8,TImode:9,OImode:10,QFmode:11,HFmode:12,TQFmode:13,SFmode:14,DFmode:15,XFmode:16,TFmode:17,QCmode:18,HCmode:19,SCmode:20,DCmode:21,XCmode:22,TCmode:23,CQImode:24,CHImode:25,CSImode:26,CDImode:27,CTImode:28,COImode:29,BLKmode:30,CCmode:31,CCXmode:32,CC_NOOVmode:33,CCX_NOOVmode:34,CCFPmode:35,CCFPEmode:36,\MAX_MACHINE_MODE:37,;mode_class:T(31,2)=eMODE_RANDOM:0,MODE_INT:1,MODE_FLOAT:2,MODE_PARTIAL_INT:3,MODE_CC:4,MODE_COMPLEX_INT:5,MODE_COMPLEX_FLOAT:6,MAX_MODE_CLASS:7,;../../gcc-2.95.1/gcc/defaults.hinclude/stddef.hptrdiff_t:t(34,1)=(0,1)wint_t:t(34,2)=(0,4)UQItype:t(0,20)=(0,11)SItype:t(0,21)=(0,1)USItype:t(0,22)=(0,4)DItype:t(0,23)=(0,6)UDItype:t(0,24)=(0,7)SFtype:t(0,25)=(0,12)DFtype:t(0,26)=(0,13)TFtype:t(0,27)=(0,14)word_type:t(0,28)=(0,1)DIstruct:T(0,29)=s8high:(0,21),0,32;low:(0,21),32,32;;DIunion:t(0,30)=(0,31)=u8s:(0,29),0,64;ll:(0,23),0,64;;/usr/include/stdio.h/usr/include/sys/va_list.h__va_list:t(36,1)=(17,71)__longlong_t:t(35,1)=(0,6)fpos_t:t(35,2)=(0,3)fpos64_t:t(35,3)=(35,1)FILE:t(35,4)=(35,5)=s16_cnt:(0,1),0,32;_ptr:(35,6)=*(0,11),32,32;_base:(35,6),64,32;_flag:(0,11),96,8;_file:(0,11),104,8;;__eprintf:F(0,19)string:P(10,4)expression:P(10,4)line:P(0,4)filename:P(10,4)  T  < < %\%\Do66`-77$  77$7$ A7<7<X K<<Q((W((]((he\\$j o  x,\~,,44<<@@1@30p'M `+ $ +D l 78q: (